(data stored in ACNUC7421 zone)

EMBL: CP001389.PE85

CP001389.PE85        Location/Qualifiers
FT   CDS_pept        89613..91610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00850"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00850"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23889"
FT                   /db_xref="GOA:C3MF52"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF52"
FT                   /protein_id="ACP23889.1"
FT                   /translation="MRIRGKIYLIVGIMSLLAVAITGMSLLIVSKYNDELGQFQNASER
FT                   SFKGERLNRLVTAVVMESRGVYAAPTIEKATPFAEGIIKNLGKIDALLKEWRPLVPADR
FT                   LPAFDAVAKRAEEFKAFRTETARLGREVSPQAANEQGNNEANRANRKAFQAEIDVVVDA
FT                   DRESLQAITDGIAAFERTVVLIVLGIAGLGMAAGIGTAFYIGTNHLSRPIVDLTGRMKL
FT                   LAGGDLSVDVPFAGRKDEIGDMAAAVEVFKQNGLAVRELNAQEAALREKSADLQSSIGI
FT                   VVAAAAAGDFAQRIGKDYDNDDLNRFAASVNELVGSVDSGIAETRRVIASLAAGDLTES
FT                   MDGSFQGAFAELQKNVNETFTTLQKTMREVRSATDSINGNASELRSAADDLSKRTEQQA
FT                   AALEETSAALDEITAAVRSSTERAHEATIMVTEAKENAAESASVVRNAIDAMGRIEQAS
FT                   SEIGQITNVIDEIAFQTNLLALNAGVEAARAGDAGKGFAVVAQEVRELAQRAASAAKDI
FT                   KGLISKSGSEVATGVKLVQATGAALGEIETRVLKINDHIHSIATAAREQSTGLGEVSTA
FT                   VNQMDQVTQRNAAMVEEANAATHKLSAEANGLATLITYFKVDREPARTITPARETARPV
FT                   ASPARRMMGTVARAFGGGSAAAARSDWEEF"
     atgagaattc gcggaaagat ctacctgatc gttggcatca tgagcctgct ggcggtcgcc        60
     atcaccggca tgtcgctgct gatcgtatcg aagtacaacg acgagctcgg ccaatttcag       120
     aacgcctccg aacgaagctt caagggcgag cgcctcaatc gtctggtcac ggccgtcgtg       180
     atggaatcgc gcggggtcta tgccgcgccg acgatcgaaa aggcgacccc cttcgccgag       240
     ggcatcatca agaacctcgg caagatcgac gcgctgttga aggagtggcg tccgctggtc       300
     ccggccgaca ggctgccggc cttcgacgcg gtggccaagc gggccgagga attcaaggcg       360
     ttccgcacgg aaaccgcccg gctcggccgc gaagtctcgc cgcaggccgc caacgagcag       420
     ggcaacaacg aagccaatcg cgccaaccgc aaggccttcc aggcggagat cgacgtggtc       480
     gtcgatgccg accgtgagtc cctccaggcc atcaccgatg gcatcgccgc cttcgaaagg       540
     acggtcgtcc tcatcgtcct cggcatcgcc ggcctcggca tggctgccgg tatcgggacg       600
     gccttctata tcggcaccaa tcatctcagc cggccgatcg tcgatctgac cggcaggatg       660
     aagctgctgg ccggcggcga cctctccgtc gacgtgccct ttgccgggcg caaggacgag       720
     atcggcgaca tggcggcagc cgtcgaagtc ttcaagcaga acgggcttgc cgtgcgcgag       780
     ctcaatgccc aggaagcggc gctgcgcgaa aagagcgccg acctgcagtc gagcatcggc       840
     atcgtcgtcg cggccgccgc cgccggcgac ttcgcccagc gtatcggcaa ggattacgac       900
     aacgatgacc tgaaccgctt cgcggcgagc gtcaacgagc tggtcggcag cgtcgacagc       960
     ggcatcgccg aaacacggcg ggtgatcgcc agcctggcgg caggcgacct gacggagagc      1020
     atggacggca gcttccaggg cgccttcgcc gaactgcaga agaatgtcaa cgagacgttc      1080
     acgaccctgc agaagacgat gcgcgaggtg cgctcggcga cggattcgat caacggcaat      1140
     gcatccgaat tgcgttcggc cgccgatgac ctgtcgaagc gtaccgagca gcaggccgcc      1200
     gcgctcgagg aaacctcagc cgccctcgac gagatcaccg cggcggtgcg cagctcgacc      1260
     gagcgggccc acgaggcgac catcatggtg acggaagcga aggaaaacgc cgccgaatcc      1320
     gcctccgtcg tccgcaacgc gatcgacgcc atggggcgca tcgagcaggc ctccagcgaa      1380
     atcggccaga tcaccaacgt catcgacgag atagccttcc agaccaacct gttggcgctg      1440
     aacgcgggcg ttgaggcggc acgggccggt gacgcgggca agggttttgc ggtcgtcgcg      1500
     caggaggtcc gcgaactcgc ccaacgcgcc gccagcgccg ccaaggacat caaggggctc      1560
     atctccaagt cgggcagcga agtggcgacc ggcgtcaagc tggtccaggc gacgggcgcc      1620
     gcgctcggcg agatcgagac acgggtgctg aagatcaacg accacatcca ttcgatcgcc      1680
     accgccgcgc gcgagcagtc gacagggctt ggcgaagtga gcaccgccgt caaccagatg      1740
     gatcaggtga cccagcgcaa tgccgcgatg gtcgaggagg cgaatgcggc gacgcacaag      1800
     ctctccgccg aagccaacgg tctcgccacc ctcatcacct atttcaaggt cgaccgcgag      1860
     ccggcaagga ccatcacccc cgccagggag acggcccgcc cggtcgcttc gccggcccgc      1920
     cgcatgatgg gaacggtggc ccgcgccttc ggcggcggtt cggccgctgc cgctcgcagc      1980
     gattgggaag aattctga                                                    1998
//

If you have problems or comments...

PBIL Back to PBIL home page