(data stored in ACNUC7421 zone)

EMBL: CP001389.PE88

CP001389.PE88        Location/Qualifiers
FT   CDS_pept        94067..95548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00880"
FT                   /product="two component sensor histidine kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00880"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23892"
FT                   /db_xref="GOA:C3MF55"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF55"
FT                   /protein_id="ACP23892.1"
FT                   /translation="MVEDARPANESAPPRAAVGFLRGLSGKLLLLTIAFVMLAEVLIFV
FT                   PSVANMRIRWLEDRLNTVAAAAVVVDGLQNIELPRAVQRETLMATGTKAIVIRRKDASR
FT                   MIATVDMPPQIDGEYDVANFTALGAIRDAFDTLLFGGTRIMRVYGPLGESEATIELVMK
FT                   DASLRKAMLVYSRNVFLLSIVISLITAALIFLAINRMLIVPIKRLTTSMQEFSDEPSSP
FT                   ERVLVPPDGGDELALAGQHLASMQRELQKTLKQQKSLAELGLAVSKINHDMRNILSSAQ
FT                   LISDRLADVDDPVVKRFAPTLLRTIDRAVGYTQEVLSYGRTAEAEPHRRFVALRPLVQD
FT                   VGELLAVDRQGGIEFDVQVRDDIMVDADSEQLFRVVHNICRNAVQALTNHQPDDGRPAM
FT                   ISVSAVRTGSVVTISIEDTGPGMPAKARENLFAAFRGSARSGGTGLGLAIARELVLAHG
FT                   GTIALVEKPTPGTLFRIELPDRPVRLDAFRAKGRS"
     atggtagaag acgcacgtcc ggccaatgag agtgcgccgc cgcgagcggc cgtcggattt        60
     ctgcgcgggc tctccggcaa gctcctgctg ctgacgatcg ccttcgtcat gctggcggag       120
     gtgctgatct tcgtgccctc cgtcgccaac atgcggatcc gctggctcga ggaccggctg       180
     aacaccgtgg cggccgccgc cgtcgtcgtc gacgggctgc agaatatcga gctgccgcgc       240
     gccgtgcagc gtgagacgct gatggcgacc ggcaccaagg cgatcgtcat ccgccgcaag       300
     gatgcgtcgc ggatgatcgc gaccgtcgac atgccgcctc agatcgacgg cgaatacgac       360
     gtcgccaatt tcaccgccct cggcgcgatc cgcgacgcct tcgatacgct gcttttcggc       420
     ggcacccgca tcatgcgggt ctatggaccg ctcggcgaga gcgaagcgac gatcgaactg       480
     gtgatgaagg atgcgagcct gcgcaaggcc atgctcgtct attcgcgcaa tgtcttcctg       540
     ctgtcgatcg tcatttcgct gatcacggcg gcgctgatct tcctcgccat caaccgcatg       600
     ctgatcgtgc cgatcaagcg cctgacgacg agcatgcagg aattttccga cgagccgtcc       660
     agtccggaac gggtcctcgt gccgccggac ggcggcgacg agctggcgct cgccggccag       720
     cacctcgcca gcatgcagcg cgagttgcag aagaccttga agcagcagaa aagccttgcc       780
     gaactcggcc ttgccgtttc gaagatcaac cacgacatgc gcaacatcct gtcctcggcc       840
     cagctcatct cggaccggct ggccgatgtc gacgatccgg tcgtcaagcg cttcgcgccg       900
     acgctgctga ggaccatcga ccgcgccgtc ggctatacgc aggaggtcct ctcctatggg       960
     cggaccgccg aggccgaacc gcatcgccgc ttcgtggcgc ttcgcccgct ggtccaggat      1020
     gtcggcgagc tgctggcggt cgatcgccag ggcggcatcg aattcgatgt ccaggtccgc      1080
     gacgacatca tggtcgatgc ggacagcgag cagcttttcc gcgtcgtgca caatatctgc      1140
     cgcaatgcag tccaggcact gacgaaccac cagcccgacg acggccgccc ggcgatgatt      1200
     tccgtctcgg ccgtccggac gggcagcgtc gtgacgattt cgatcgagga taccggcccg      1260
     ggcatgccgg ccaaggcacg cgaaaatctc ttcgccgctt tccgcggctc ggcgcgctcc      1320
     ggcggcaccg ggctcggtct cgcgatcgct cgcgaactgg tgctcgccca tggcggcacg      1380
     attgcgctgg tcgaaaagcc gacgcccggc acgctgtttc gcatcgagct tccggaccgc      1440
     ccggtgcggc tcgacgcctt ccgcgccaag ggccgctcgt ga                         1482
//

If you have problems or comments...

PBIL Back to PBIL home page