(data stored in ACNUC7421 zone)

EMBL: CP001389.PE9

CP001389.PE9         Location/Qualifiers
FT   CDS_pept        complement(7749..8258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00090"
FT                   /product="predicted glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00090"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23813"
FT                   /db_xref="GOA:C3MEJ0"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEJ0"
FT                   /protein_id="ACP23813.1"
FT                   /translation="MPNSSRCRSRRSPARACGRFAPWHCKLRGTTLAAALEGILETALY
FT                   ADDLDAAEAFYGNVLGLARITRVGNRHVFFRCGDGVLLIFNAAETVKPPAAGALPVPSH
FT                   GTQGKGHMCFRVGAPALEAWKAKLEAAGVAIEADIRWPNGARSFYFRDPAGNSLECAEP
FT                   GLWDID"
     ttgccgaact cgtcgcgttg cagaagcagg cggtcgccgg ctagggcgtg cgggcggttt        60
     gcgccctggc actgcaagct gagaggaacg acgttggctg cggctcttga aggcatcctc       120
     gaaaccgcgc tctacgcgga cgatctcgac gccgccgagg cgttctacgg caacgtcctc       180
     gggctcgccc ggatcacccg cgtcggcaac cgccacgtct ttttccgctg cggcgacggc       240
     gtgctgttga tcttcaacgc ggcggaaacg gtgaaaccgc ccgctgccgg cgcgctgccc       300
     gtgccgtcgc acggcacgca aggcaagggt cacatgtgct tccgcgttgg agcgccggcg       360
     ctcgaggcct ggaaggcgaa gctggaggcg gccggcgtgg cgatcgaggc ggatatccgc       420
     tggccgaacg gcgcccgctc gttctatttc cgcgacccgg ccggtaacag cctggagtgc       480
     gcggaacctg gcctgtggga catcgattga                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page