(data stored in ACNUC7421 zone)

EMBL: CP001389.PE90

CP001389.PE90        Location/Qualifiers
FT   CDS_pept        complement(96498..97679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00910"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23894"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF57"
FT                   /protein_id="ACP23894.1"
FT                   /translation="MTRIHMRRLAVARTGAVLLAFPVAAMAEDRLPILAEDCTAPCAGY
FT                   EVTAELQNDWVFAADPSLLKSDELEPTITVDLFLAPTDNLRFVASIITEQVVEPEAGEN
FT                   AVFQGIGTYLAELYTAVATGPATIRAGKFDTIFSLASEVAPGINATELVSDIDADERLG
FT                   AEVVLDFGGLGMEQVLAATAFTTDRSVLGNSLFTRRGRTRLSDGGAGNTDGLSSFSMTL
FT                   DGCRGSEPIDCYLEGDFGYRLGIRYQAAGAQSGEDTEDSPGDEVGYLAAATTSLELDEM
FT                   TLRLLGETAYLRHFDGGSDDALLLTGSAALELEPVTYVASYTQQLNLVAGEPDRREHLA
FT                   DFEAIYEPREGTSLEGWEFAAAYTVARDADETAHIFSVRAVFNFDGDAELGSR"
     atgacaagga tccatatgcg ccgtctcgcc gtggctcgca ccggtgccgt gttgctggcg        60
     ttcccggttg cagccatggc cgaagaccgt ctgccgatcc ttgccgaaga ctgcactgcg       120
     ccctgtgcag gctatgaggt tacggccgaa ctccagaacg actgggtgtt tgccgccgac       180
     ccctccttgc tgaagtccga cgaactggaa ccgacgatca ccgttgacct gttcctggca       240
     ccaaccgaca atctccgctt cgtcgcctcc atcatcaccg agcaggtcgt cgagccggaa       300
     gccggcgaga atgcggtctt tcaaggcatc gggacctacc tggccgaact ctacaccgcc       360
     gtcgcaacgg gtcccgccac cataagggcc ggaaaattcg acacgatctt cagccttgcg       420
     agcgaggtcg cgccggggat caacgccacc gagttggtct cggatatcga cgcggacgag       480
     cgccttggcg ccgaggtcgt gcttgacttc ggcggccttg gcatggagca ggtcctggcg       540
     gcgactgcct ttacgaccga ccggtcggtc ctcggcaatt ccctcttcac ccgacgcggc       600
     cggacgagat tgtccgatgg cggcgccggc aataccgatg gcctgtcctc cttctcgatg       660
     acacttgacg gctgccgggg gtcggaaccg atcgattgct atctggaggg tgatttcggg       720
     tacaggctcg gcatccggta tcaggccgcc ggagcgcaga gcggcgaaga cacagaagac       780
     agtcctggcg acgaagtcgg ctatctggcc gccgcgacga cgagcctgga actggacgaa       840
     atgacgctca gattgctcgg cgagaccgct tatctccggc atttcgacgg cggctccgac       900
     gatgccttgc tcctcacggg ctccgcggca cttgaactgg agccggtgac ttatgttgcg       960
     agctatacgc aacaactgaa tctcgttgcg ggggaaccgg acaggcgcga gcaccttgcc      1020
     gatttcgaag ccatctacga gccccgggaa ggcacatcac tcgaaggttg ggaattcgcc      1080
     gccgcctaca cggttgcgcg cgacgccgac gagaccgccc acatcttcag cgttcgagcg      1140
     gtgttcaatt tcgacggcga cgcggaactc gggtcgcggt ga                         1182
//

If you have problems or comments...

PBIL Back to PBIL home page