(data stored in ACNUC7421 zone)

EMBL: CP001389.PE91

CP001389.PE91        Location/Qualifiers
FT   CDS_pept        98110..99852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00920"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23895"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF58"
FT                   /protein_id="ACP23895.1"
FT                   /translation="MPNFAAATFNPGAPINNPYLPLIPGHVLSYMGDETDPDTGEVTTE
FT                   RNDVFTTSASFEVRGVATTVIRDTVYEDDVIIEDTFDWYAQDTAGNVWYFGEIVVNYEY
FT                   DDDGNFVGVNHDGQWSADDPGNQPGWAMKASPEFGPAYYLEFAPGIAEDESILAETGLS
FT                   VKTSFGQFEDVIKIIDSSALSTGVEFKYYAPGVGEITETAVAPDGTATSQVDLYRNGIV
FT                   GQVDADDSDDVTPALAKLKESKTVEDLAEIRDLEMADFAGIGTTKQVTVIGGSTDSADA
FT                   LGAYFIDEATGAISEGRILVADLSDAASGTSIAVDVPDGQSLCLFLVRGTDEIGVDLEQ
FT                   FADGGMQLKNLLTGAPANVNDPFAPTVMDDAGNILPIQPLSALGADDGGNLLNPAGSMQ
FT                   AIGLSSSAAGASGIEIIGFEDRLNTSPDYDGDFNDAILAVSDAPIPAETLQQLVREAGG
FT                   GKTASSGIAQSSNEPAGEVPDGEQAEEADDSGTGESLEDTLDEWLTGDTFVFADGAHRV
FT                   GRVADLELDRWDGFLVDGDWVDFSHLERLCNDHPDGIGAHFDGVPDGVLKAGAALSADG
FT                   FFIA"
     ttgcccaatt ttgcggcggc gaccttcaac cccggagcgc cgatcaacaa cccttatctt        60
     ccgctgatcc cgggtcatgt cctgagttac atgggcgatg agacagatcc cgacaccggc       120
     gaggtcacaa cggagcgaaa cgacgtcttc accacctctg cgagtttcga ggtgcgtggc       180
     gttgcgacca ccgtgatccg cgacacggtc tacgaggacg atgtcatcat cgaggatacc       240
     ttcgattggt acgcgcagga taccgcaggc aatgtctggt atttcggcga gatcgtcgtc       300
     aactacgaat atgacgacga cggcaatttc gtcggcgtca atcacgacgg ccaatggtcg       360
     gccgacgatc ccggcaacca gccgggctgg gcgatgaagg cgagtccgga attcggcccg       420
     gcctattatc tggagttcgc acctggcatc gccgaggacg aaagcatcct cgccgagacc       480
     ggactcagtg tcaaaacgtc cttcgggcaa tttgaagacg tcatcaagat cattgacagt       540
     tcggcactct ccaccggggt cgagttcaaa tactatgctc cgggcgtggg tgagatcacc       600
     gaaaccgccg tcgcaccgga cggcacggcg acgtcgcagg tcgacctcta ccgcaacgga       660
     attgtcggcc aggtggatgc cgacgacagt gacgacgtca cccctgcctt ggcgaagctc       720
     aaggaatcca agacggtcga ggatctcgcc gagatacggg atcttgaaat ggcggacttc       780
     gccgggatcg ggacaacgaa gcaggtcacg gtgatcggcg gctcgacgga cagcgccgat       840
     gcgctgggcg cctatttcat cgatgaggcg accggcgcca tcagcgaggg gcgcatactg       900
     gtcgcggatc tctccgatgc ggcgagcggc acatccattg ccgtcgacgt tccggacggc       960
     cagagcctgt gcctcttcct ggtgcgcggc accgacgaga tcggcgtcga cctggagcag      1020
     ttcgctgacg gcggcatgca actgaagaac cttctgaccg gcgcaccggc caatgtgaat      1080
     gatcccttcg ctccgaccgt catggacgat gccggcaaca tcctgccgat ccaacccttg      1140
     agcgcgctgg gtgccgacga cggtggcaat cttctgaacc ccgccggcag catgcaggcg      1200
     atcgggctat cgtcgagcgc agcaggggca agcggcatcg agatcatcgg cttcgaggac      1260
     cggctgaaca ccagtcccga ctatgacggt gatttcaatg acgcgatctt ggctgtcagc      1320
     gacgcgccga tcccggccga aacgctccag caactcgtcc gtgaagccgg aggcgggaaa      1380
     actgccagca gcggaattgc ccagtcgagc aacgaacccg cgggcgaggt ccccgacggc      1440
     gagcaagccg aggaggcgga cgacagcggg actggagaat cgctggagga tacgctggac      1500
     gagtggctga ccggcgacac ctttgtgttc gccgatgggg ctcatcgtgt cgggcgggtc      1560
     gccgatctcg aactcgatag gtgggacggg ttcctcgtgg acggcgattg ggttgacttc      1620
     agccatctcg aacgcctttg taatgatcac cctgatggca tcggtgcgca ctttgacggc      1680
     gtaccggacg gtgtcttgaa ggccggggcc gcgctcagcg ccgatggctt cttcatcgcc      1740
     tga                                                                    1743
//

If you have problems or comments...

PBIL Back to PBIL home page