(data stored in ACNUC7421 zone)

EMBL: CP001389.PE92

CP001389.PE92        Location/Qualifiers
FT   CDS_pept        99902..100561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00930"
FT                   /product="hypothetical protein associated with LuxR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00930"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23896"
FT                   /db_xref="GOA:C3MF59"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF59"
FT                   /protein_id="ACP23896.1"
FT                   /translation="MAAVLRVAGRRRQRRWAMDWTKGRGRQILIFGAVGTFALLLGLEV
FT                   VKEEEEWTVAELLTEAVSIALLVGCSACVALLSSRLREQEADNLDLRDKVARIRESNAQ
FT                   WRADLADHFQELGAAIQRQFGAWGCTQAEQEVGLLLLKGFSHKEIARIRGASEATIRQQ
FT                   ATSVYHKAELSGRAALSAYFLEELLLPPVPTAQTSARGDGVARPENAEVSGRIVPG"
     atggcggcgg tactgcgagt tgcggggcgc cgccgccagc ggcgatgggc gatggattgg        60
     accaagggac gcggccggca gatcctgatc tttggtgcgg tgggaacctt cgcgctgttg       120
     ctgggactgg aagtggtgaa ggaagaggag gaatggaccg tcgcggaatt actgacggag       180
     gcggtgagca ttgcgcttct tgtcggttgc tcggcctgcg tggcgctgct ctcgtcgcgt       240
     cttcgcgagc aggaggcgga taacctcgat ctgcgcgaca aggtcgcgcg catccgcgaa       300
     agcaacgctc agtggcgtgc cgatctggcg gatcactttc aggagctcgg cgccgccatc       360
     cagcgccaat tcggggcctg gggctgcacc caggctgagc aggaggtcgg attgctgctg       420
     ctcaagggct tcagccacaa ggagatcgcc cggattcgcg gagcgagcga agcgacaatt       480
     cgccagcagg cgacgtcggt ttaccacaag gcggagctct ccggtcgcgc cgcgctttcc       540
     gcctattttc tggaggagct gctcttgccg cccgtgccga cggcgcagac ttccgcccgc       600
     ggcgacggtg tcgctcgtcc cgaaaacgcc gaggtctccg ggcgcatcgt gcctggctga       660
//

If you have problems or comments...

PBIL Back to PBIL home page