(data stored in ACNUC7421 zone)

EMBL: CP001389.PE94

CP001389.PE94        Location/Qualifiers
FT   CDS_pept        complement(101582..102010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00950"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23898"
FT                   /db_xref="InterPro:IPR014937"
FT                   /db_xref="InterPro:IPR036287"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF61"
FT                   /protein_id="ACP23898.1"
FT                   /translation="MSEAFDLERFVKAQEGVYESALAELRAGAKRTHWMWFIFPQIQGL
FT                   GHSSMAQYYALADLDEARAFLKHPLLGRRLRECTEAVNAVRGRSALSILGRPDDLKFRS
FT                   SMTLFEAADPTVGAFAKALDHYYHGARDPRTMEILGGA"
     atgagcgagg ccttcgatct cgaacgtttc gtcaaggcgc aggagggcgt ctacgagagc        60
     gcgctggcgg agcttcgcgc cggcgccaag cggacccact ggatgtggtt catctttccg       120
     cagatccagg gcctaggcca ttcgtcgatg gcgcagtatt acgcgctggc ggatctcgac       180
     gaggcgcggg cctttctcaa gcacccgctg ctcggccggc gacttcgtga atgcacggag       240
     gctgtgaacg cagtcagagg gcgcagcgct ctctccatcc tcggccggcc ggacgatctg       300
     aagttccgct cgtcgatgac gctcttcgag gccgccgacc cgactgtcgg agcttttgca       360
     aaagcgctcg accattatta ccacggcgcc cgagatcccc gaacgatgga aatcctcggc       420
     ggggcttga                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page