(data stored in ACNUC7421 zone)

EMBL: CP001389.PE96

CP001389.PE96        Location/Qualifiers
FT   CDS_pept        complement(103136..103915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00970"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00970"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23900"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF63"
FT                   /protein_id="ACP23900.1"
FT                   /translation="MPHTLHSLLTDATRPKFSGRALGRNGRQSPSHLWGGAMLRLGKQS
FT                   IEDDEAPPFRYQRCQTGKQRMFTLQRIETSAQEIRKSRFVAIAGSIDDEQAAKAFLAAH
FT                   SEPAANHNCWAWRIGQTYRFNDDGEPSGTAGKPILAAIDGQSLDRVVVVVTRWFGGVLL
FT                   GSGGLIRAYGGTAALCLRAAEKVERVETHRATVACDFADLALIKARLTARGIAIASESF
FT                   TDTGAMLVIDFRKDAAEATLTLVSDLSRGRAIVSLDT"
     atgccgcaca ctcttcactc ccttttgacc gatgcaacga ggccgaaatt ttcaggcagg        60
     gcactcggcc gcaacgggcg ccaaagcccc tcccaccttt ggggaggggc gatgctgcgc       120
     ctcggcaagc agtccatcga ggatgacgaa gcgcctccat tccgctatca gcgttgccaa       180
     accgggaagc agcggatgtt cacgctccag cgcatcgaga cctcggcaca ggaaatcagg       240
     aagagccgct ttgtggcgat cgccggctcg atcgacgacg agcaagcggc aaaggccttt       300
     ctcgccgccc attccgagcc ggccgccaac cacaattgct gggcctggcg gatcggccag       360
     acataccgct tcaatgacga tggcgagccg agcggcacgg cgggcaagcc gatcctggcg       420
     gcgatcgacg gccagtcgct cgaccgggtc gtggtcgtcg tgacgcgctg gttcggcggc       480
     gttctgctcg gcagcggcgg cctgatccgc gcctatggcg gcaccgccgc actctgtctc       540
     agggcggcgg aaaaggtcga acgggtcgag acgcaccgtg ccacggtcgc ctgcgacttc       600
     gccgatctcg ccctcatcaa ggcacggctc accgcccgcg gcatcgcgat cgccagcgaa       660
     agcttcaccg acaccggtgc catgctggtg atcgattttc ggaaggacgc ggcggaagcc       720
     acactcaccc tggtgagtga tctcagtcgc ggcagggcga tcgtttcgct cgatacctga       780
//

If you have problems or comments...

PBIL Back to PBIL home page