(data stored in ACNUC7421 zone)

EMBL: CP001389.PE98

CP001389.PE98        Location/Qualifiers
FT   CDS_pept        complement(107866..108180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00990"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23902"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF65"
FT                   /protein_id="ACP23902.1"
FT                   /translation="MTSALSPHHDFDCQSCGACCAYSAEWPRFSLETEEELEQIPADHV
FT                   AADLGGMRCENDRCTALEGTLGKFVACKVYAVRPIVCRTCMPGDDECLMARQRLFGAAA
FT                   "
     atgacttctg ccctttcccc ccatcacgat ttcgattgcc agagctgtgg cgcctgttgc        60
     gcctattcgg ccgaatggcc gcgtttctcg ctggagacgg aagaggagct ggaacaaata       120
     ccggccgacc atgtggcggc cgaccttggc ggcatgcgct gcgaaaacga ccgctgcacg       180
     gcgctcgagg gcacgctcgg caaattcgtc gcttgcaagg tctatgccgt caggcccatt       240
     gtctgccgga cctgcatgcc cggcgatgac gaatgcctga tggcccgcca acggcttttt       300
     ggtgccgccg cctga                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page