(data stored in ACNUC7421 zone)

EMBL: CP001389.PHOB

CP001389.PHOB        Location/Qualifiers
FT   CDS_pept        169361..170044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoB"
FT                   /locus_tag="NGR_c01490"
FT                   /product="phosphate regulon transcriptional regulatory
FT                   protein PhoB"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01490"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23951"
FT                   /db_xref="GOA:C3MFB4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011879"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFB4"
FT                   /protein_id="ACP23951.1"
FT                   /translation="MLPKIAVVEDEEALSVLLRYNLEAEGFEVDTILRGDEAEIRLQER
FT                   LPDLLILDWMLPGVSGIELCRRLRQRPETERLPIIMLTARGEESERVRGLATGADDYVV
FT                   KPFSTPELMARVKAMLRRAKPEVLSTVLRCGDIELDRETHRVHRRSREVRLGPTEFRLL
FT                   EFLMSSPGRVFSRSQLLDGVWGHDIYVDERTVDVHVGRLRKALNFSNMPDVIRTVRGAG
FT                   YSLES"
     atgttgccga agatagccgt tgtcgaggac gaggaagccc tgagcgtgct gctgcgctac        60
     aatctcgagg ccgagggctt cgaggtcgat acgatccttc gcggcgacga ggcggaaatc       120
     cgtctgcagg aacgcctgcc cgaccttctg atcctcgact ggatgctgcc cggagtctcc       180
     ggtatcgagc tttgccgccg gctgcggcag aggccggaga ccgagcggct gccgatcatc       240
     atgctgacgg cgcgcggcga ggaaagcgaa cgggtgcggg ggctcgcgac cggtgccgac       300
     gattatgtcg tcaagccgtt ctcgacgccg gaactgatgg cgcgggtgaa ggccatgctc       360
     cggcgcgcca agccggaggt gctgtcgaca gtgcttcgct gcggcgacat cgagctcgac       420
     cgcgaaacac accgcgtgca tcgccgcagc cgcgaagtgc ggctcggccc gacggagttc       480
     cggctcctcg aattcctgat gtcctcgccg ggccgtgtgt tctcccgttc gcagctgctc       540
     gacggcgtct ggggacacga catctatgtc gacgaacgta ccgtcgacgt ccatgtcggc       600
     cggctgcgca aggccctgaa tttctccaat atgcccgacg tgatccggac ggtgcgcggc       660
     gccggctatt cgctggaaag ctga                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page