(data stored in ACNUC7421 zone)

EMBL: CP001389.PHOH

CP001389.PHOH        Location/Qualifiers
FT   CDS_pept        44670..45725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoH"
FT                   /locus_tag="NGR_c00420"
FT                   /product="phosphate starvation inducible family protein
FT                   PhoH"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00420"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23846"
FT                   /db_xref="GOA:C3MF09"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF09"
FT                   /protein_id="ACP23846.1"
FT                   /translation="MNGHEMISSSSRHSKTTATDANHFVLTFENNRFASELFGQFDQNL
FT                   KLLEERLRVDARPRGNSVAISGDVVATNQARRALDYLYGRLQSGASIDTSDVEGAIRMA
FT                   VAADDQLQLPTMERKAKLTMAQISTRKKTIAARTPMQDAYIRAMERSELVFGVGPAGTG
FT                   KTYLAVAHAAQLLERGAVDRIILSRPAVEAGERLGFLPGDMKEKVDPYLRPLYDALYDM
FT                   MPGDKVERAISAGVIEIAPLAFMRGRTLANAAVILDEAQNTTSMQMKMFLTRLGENGRM
FT                   IVTGDPSQVDLPRGVKSGLVEALQILKGVEGVSVIRFKDADVVRHPMVARIVRAYESHT
FT                   AVHDESEQSDR"
     ttgaacggac acgaaatgat ttcatcctca tcgcgccatt cgaagacgac cgcgacagac        60
     gccaatcact tcgtgctcac gttcgagaac aaccggttcg ccagcgaact cttcggccag       120
     ttcgaccaga atttgaaact gctcgaggag cgactgcgtg tcgacgccag gccgcgcggc       180
     aattccgtgg ccatctccgg cgatgtcgtg gcgaccaacc aggcacggcg tgcgctcgac       240
     tatctctatg gaagactgca aagtggggcc tcgatcgata cgtccgacgt cgaaggggcg       300
     atccgcatgg cggtcgccgc cgacgaccag ctgcagttgc cgaccatgga gcgcaaagcc       360
     aagttgacga tggcgcagat ttcgacgcgc aagaagacaa tcgctgcgcg caccccgatg       420
     caggatgcct atatccgcgc catggagcgg tccgagctcg tcttcggcgt cggcccggcc       480
     ggcaccggca agacctatct cgccgtcgcc cacgccgccc agcttctgga gcgcggcgcg       540
     gtcgaccgga tcatcctgtc gcggccggcg gtcgaggcag gcgagcggct cggcttcctg       600
     cccggcgaca tgaaggagaa ggtcgatccc tatctgaggc cgctctacga tgcgctctac       660
     gacatgatgc cgggcgacaa ggtggagcgg gcgatttcgg ccggcgtcat cgagatcgcg       720
     ccgctggcct tcatgcgcgg ccggacgctc gccaatgctg ccgtcattct cgacgaggcg       780
     cagaacacca cctcgatgca gatgaagatg ttcctgaccc gcctcggcga aaacggcagg       840
     atgatcgtca ccggcgaccc gagccaggtc gacctgccgc gcggcgttaa atccggcctc       900
     gtcgaagcgc tgcaaatcct caaaggcgtg gagggcgtgt cggtcatccg cttcaaggat       960
     gccgatgtgg tgcgtcatcc catggtggcg cggatcgtca gggcctatga aagccacacg      1020
     gccgtccacg atgaaagcga acagagcgat cgctga                                1056
//

If you have problems or comments...

PBIL Back to PBIL home page