(data stored in ACNUC7421 zone)

EMBL: CP001389.PHOR

CP001389.PHOR        Location/Qualifiers
FT   CDS_pept        162355..163599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoR"
FT                   /locus_tag="NGR_c01430"
FT                   /product="two component sensor histidine kinase protein,
FT                   phosphate regulon sensor PhoR"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01430"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23945"
FT                   /db_xref="GOA:C3MFA8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR014310"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFA8"
FT                   /protein_id="ACP23945.1"
FT                   /translation="MENEGAKVFWQGLKPKLKAERWILGLSIVLAVLAALAGIHVLAVF
FT                   AFWLVLAAALLKRSAPSAEPLPEAAPRIVEARTDALVPALNALDMPVLVIGADETVLFQ
FT                   NTAAEKAFGTIPPESYLSARVRSPGILDMVRETIATGKVNQIEHSERLPSDAVYVVRVA
FT                   PADIGGETLGGRVFLLTYRDISQTRRIDRMRSDFVANASHELRTPLASLRGFIETLAGP
FT                   ARNDLKAQEKFFGIMHEQVTRMSRLVDDLLSLSRLELKSHIAPEDAVDLVPLLGHVRDS
FT                   LQPLASDLDVTISLEVPEEPVFVQGDRDELIEVFENLIENACKYGQEGKKVDVRLTGSG
FT                   GQAEVTVTDHGPGIPAEHVPRITERFYRVNVEASRSKKGTGLGLAIVKHILTRHRARLL
FT                   IHSEVGKGTVFTVRF"
     ttggagaacg agggcgcgaa agtgttctgg cagggcctca agccgaagct gaaggcagag        60
     cgctggatcc ttggcctctc catcgtgctt gccgtcctcg ccgccctcgc cggtatccat       120
     gttctggcgg tgttcgcctt ctggctcgtt ctcgcggcag ccctgctcaa gcgaagtgcc       180
     ccatcggcag agccgctgcc ggaggcggcg ccgcgaatag tggaggcgcg gaccgacgca       240
     ctggttcccg cgctgaatgc gctcgatatg ccggtgctcg tcattggcgc ggacgagacc       300
     gtgcttttcc agaacactgc cgccgagaag gccttcggca caattccccc ggagagctac       360
     ctttcggcgc gcgtccgctc tcccggaata ctcgacatgg tgcgcgagac cattgcgacg       420
     ggtaaagtca accagatcga gcattcggaa cgcttgcctt cggatgcggt ctatgtcgtc       480
     cgcgtcgccc cggcggatat cggcggcgag acccttggcg ggagggtctt cctgctgacc       540
     tatcgcgaca tctcgcagac ccgccgcatc gaccggatgc gatccgactt cgttgccaat       600
     gccagccacg aactgcgcac cccgctcgct tcgctgcgcg gcttcatcga gacactggcc       660
     gggccggcca ggaacgactt gaaggcgcag gagaaattct tcggcatcat gcacgaacag       720
     gtcacccgca tgagccgcct cgtcgacgat ctcctgtccc tgtcgcgcct ggaactgaag       780
     tcgcacatcg ccccggaaga cgcagtcgac ctggtgccgc tgctcgggca cgtgcgcgac       840
     agccttcagc ccttggccag cgatctcgac gtgaccatct cgctcgaggt gcccgaggag       900
     ccggtcttcg tccagggcga ccgcgacgaa ctgatcgagg tcttcgaaaa tctcatcgag       960
     aacgcctgca aatacggcca ggaaggcaag aaggtcgacg tgcggctgac gggcagcggc      1020
     ggccaggcgg aggtaacggt caccgaccat ggccccggca tcccggccga gcatgtgccg      1080
     cggatcaccg agcgtttcta ccgggtcaat gtggaggcga gtcggtcaaa aaaggggacc      1140
     ggcctcggcc tcgccatcgt caagcacatc ctgacccgtc accgcgcccg cctgctcatt      1200
     cattccgagg tcggcaaggg taccgtcttc acggtccgct tctga                      1245
//

If you have problems or comments...

PBIL Back to PBIL home page