(data stored in ACNUC7421 zone)

EMBL: CP001389.PHOU

CP001389.PHOU        Location/Qualifiers
FT   CDS_pept        168597..169313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoU"
FT                   /locus_tag="NGR_c01480"
FT                   /product="phosphate transport system protein PhoU"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01480"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23950"
FT                   /db_xref="GOA:C3MFB3"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFB3"
FT                   /protein_id="ACP23950.1"
FT                   /translation="MMSHPHITTAFDEELKYLTRRISEMGGQAEQMVADSVRALVNSDL
FT                   ALAQKVISDDAILDDAERQIGEKAIVTIAKRQPMAADLREIMGSIRIAADLERVGDLGK
FT                   NTAKRVIAVAGSGIPRKLARGLEHLAELALIQLKEVLDVYASRSPEKANSIRERDEEID
FT                   AIYTSLFRELLTYMMEDPRNITPCTHLLFCAKNIERIGDHATNIAETIYYMATGAQPQG
FT                   ERPKDDMTSTLGSVTD"
     atgatgtccc acccccatat aacgaccgcc ttcgacgaag agctgaaata tctgacccgc        60
     cggatctcgg agatgggcgg ccaggccgaa cagatggtgg cggattccgt ccgcgctctg       120
     gtgaactccg acctggcgct tgcccagaag gtgatttccg acgacgctat cctcgacgac       180
     gccgagcggc agatcggcga gaaggcgatc gtcacaatcg ccaagcgtca gccgatggca       240
     gcggacctcc gcgagatcat gggctcgatc cggatcgcgg ccgatctgga gcgcgtcggc       300
     gacctcggca agaataccgc caagcgggtc atcgcggttg ccgggtccgg cataccgcgc       360
     aagctggcgc gcggcctcga gcatctcgcc gagcttgccc tgatccagct caaggaagtt       420
     ctggacgtct acgcctcgcg ttcgccggag aaggccaaca gcattcgtga acgcgacgag       480
     gagatcgacg cgatctacac gtcgctgttc cgcgagctct tgacctacat gatggaagat       540
     ccgcgcaata tcacgccctg cacgcatctt ctcttctgcg ccaagaatat cgagcggatc       600
     ggcgaccacg cgaccaacat cgccgagacg atctactaca tggcgacggg cgcccagccg       660
     cagggcgaac ggccgaagga cgacatgacg tcgacgctgg gttccgtcac cgactga          717
//

If you have problems or comments...

PBIL Back to PBIL home page