(data stored in ACNUC7421 zone)

EMBL: CP001389.POTH

CP001389.POTH        Location/Qualifiers
FT   CDS_pept        372725..373636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potH"
FT                   /locus_tag="NGR_c03300"
FT                   /product="putrescine ABC transport system permease protein
FT                   PotH"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03300"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24128"
FT                   /db_xref="GOA:C3MGL3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGL3"
FT                   /protein_id="ACP24128.1"
FT                   /translation="MAKLASALVSRLVIIVPYAWLLFFFLIPFFIVFRISLSQTAVAMP
FT                   PYTPVFDLAGGLAGLLEKAREFSVDNYVWLTDDALYFNAYVSSLVIAAISTFLTLLIGF
FT                   PVAYGMAKAPRSIRPTLLMLVILPFWTSFLIRVYAWIAILKPEGLLNQFLITIGIIDQP
FT                   LIILNTNTAIYIGIVYSYLPFMVLPIYSALEKMDNALIEAAQDLGCTPTSAFWRVTFPL
FT                   SLPGVIAGCLLVFIPAVGEFVIPDLLGGSETLMIGKTLWNEFNANRDWPVSSAVAIILL
FT                   MILVIPIVYFQNVQGKADSEGK"
     atggcgaaac ttgcctcagc cctcgtcagc cggctggtga tcatcgtccc ctatgcgtgg        60
     ctcctgtttt tcttcctcat ccccttcttc atcgtgttcc gcatctcgct ttcgcagact       120
     gcggttgcca tgccgcccta tacgccggtc ttcgatctgg ccggggggct ggccggcctt       180
     ctggagaagg cccgcgaatt ctccgtcgac aactatgtgt ggctgaccga cgacgcactc       240
     tatttcaatg cctatgtgtc gagcctggtc atcgccgcca tctcgacctt cctgacgctg       300
     ctgatcggct tcccggtcgc ctatggcatg gccaaggcgc cgcgctcgat ccggccgacg       360
     ctgctaatgc tggtgatcct gcccttctgg acgagcttcc tgatccgcgt ctatgcctgg       420
     atcgccatcc tgaagccgga agggctgctc aatcagttcc tgataacgat cggcatcatc       480
     gatcagccgc tgatcatcct caacaccaac acggcgatct atatcggcat cgtctattcc       540
     tatcttccct tcatggtgct gccgatctac tcggcgctgg agaagatgga caacgcgctg       600
     atcgaggcgg cgcaggacct cggctgcacg ccgaccagcg ccttctggcg cgtcaccttc       660
     ccgttgtcgc tgcccggagt cattgccggc tgcctgctcg tcttcattcc ggccgtcggc       720
     gaattcgtca ttcccgacct gctcggcgga tcggagacac tgatgatcgg caagacgctc       780
     tggaacgagt tcaatgccaa ccgcgactgg ccggtgtctt cggcggtggc gatcatcctg       840
     cttatgatcc tggtcatccc gatcgtctat ttccagaacg ttcagggcaa ggccgacagc       900
     gagggcaagt aa                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page