(data stored in ACNUC7421 zone)

EMBL: CP001389.POTI

CP001389.POTI        Location/Qualifiers
FT   CDS_pept        373640..374461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potI"
FT                   /locus_tag="NGR_c03310"
FT                   /product="putrescine ABC transporter system permease
FT                   protein PotI"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03310"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24129"
FT                   /db_xref="GOA:C3MGL4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGL4"
FT                   /protein_id="ACP24129.1"
FT                   /translation="MEKWSRFNVASVVLGFGFLYLPIVLLVIFSFNESKLVTVWAGFST
FT                   KWYSQLWHNQGLLDAAWVTIRVGLLSATCATVLGTLAAIALVRYSRFRGRVLFSGMVYA
FT                   PLVMPEVITGLSLLLLFVAIGLDRGFWTITLAHITFTMCFVAVVVQSRLLSFDQSIEEA
FT                   ALDLGATPVRTFFAITLPVIAPAVFSGWVLAFTLSLDDLVISSFTTGPGATTLPMKIYS
FT                   QVRLGVTPEINAICTILIGVVALGVVVASIVTKRREVQRERDERAAIAAIG"
     atggaaaaat ggtcccgctt caacgtcgcc tccgtcgtgc tcggcttcgg ctttctctac        60
     ctgcccatcg tgctgctggt gatcttctct ttcaacgagt cgaaactcgt caccgtctgg       120
     gccggttttt cgaccaagtg gtacagccag ctttggcaca accagggcct cctcgatgcc       180
     gcctgggtga ccattcgcgt cgggctgctg tcagccacct gcgcgaccgt tctcggcaca       240
     ttggcggcaa tcgcgctggt gcgctattcg cgctttcgcg gacgcgtact tttctccggc       300
     atggtctacg cgccgctggt catgccggag gtgatcaccg gcctgtcgct gttgctgctg       360
     ttcgtggcga tcgggctcga tcgcggtttc tggacgatca cgctcgccca catcaccttc       420
     accatgtgct tcgtggcggt cgtcgtgcag tcgcgcctgt tgagcttcga ccagtccatc       480
     gaggaggcgg cgctcgatct cggcgcgacc ccggtccgga ccttcttcgc catcaccctg       540
     ccggtgatcg cgccggcggt tttctcaggg tgggtcctgg ctttcacgct gtcgctcgac       600
     gacctcgtca tctcgagttt caccactggg ccgggtgcga cgacgctgcc gatgaagatc       660
     tacagccagg tgcgcctcgg cgtgacgccg gagatcaatg cgatctgcac catcctgatc       720
     ggcgtggtcg cactgggcgt cgtcgtcgca tcgatcgtca ccaagcggcg ggaagttcag       780
     cgtgaaaggg acgagcgcgc cgccatcgcg gcaatcggct ag                          822
//

If you have problems or comments...

PBIL Back to PBIL home page