(data stored in ACNUC7421 zone)

EMBL: CP001389.PUTA1

CP001389.PUTA1       Location/Qualifiers
FT   CDS_pept        complement(103970..107677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="putA1"
FT                   /locus_tag="NGR_c00980"
FT                   /product="bifunctional PutA protein; includes: Proline
FT                   dehydrogenase; Delta-1-pyrroline-5-carboxylate
FT                   dehydrogenase"
FT                   /EC_number="1.5.99.8"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00980"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23901"
FT                   /db_xref="GOA:C3MF64"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR005933"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR024082"
FT                   /db_xref="InterPro:IPR024089"
FT                   /db_xref="InterPro:IPR025703"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="InterPro:IPR041349"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF64"
FT                   /protein_id="ACP23901.1"
FT                   /translation="MSQTQLQKPTISTDAAPAPFADFAPPIRTQTTLRQAITAAYRRPE
FT                   TECLPPLVEAATLPRGTRDAAAGTARKLVEALRAKHKGSGVEGLVQEYSLSSQEGVALM
FT                   CLAEALLRIPDTATRDALIRDKISDGNWKSHLGGGRSLFVNAATWGLVVTGKLTSTVND
FT                   RSLAAALTRLISRCGEPVIRRGVDMAMRMMGEQFVTGETIDEALRRARALEQKGFRYSY
FT                   DMLGEAATTAADAERYYKDYEAAIHAIGKASAGRGIYEGPGISIKLSALHPRYARTQAA
FT                   RVMGELLPKVKALALLAKTYDIGFNIDAEEADRLELSLDLLEELCLDSDLADWNGMGFV
FT                   VQAYGKRCPFVLDFIIDLARRAGRRIMVRLVKGAYWDAEIKRAQLDGLEDFPVFTRKIH
FT                   TDVSYIACARKLLSATDAVFPQFATHNAQTLATIHHMAGKDFHVGKYEFQCLHGMGEPL
FT                   YEEVVGRENLGRPCRIYAPVGTHETLLAYLVRRLLENGANSSFVHRIADPGVSIDALIA
FT                   DPVEIVRAMPVVGAKHEKIALPAELFGAARPNSAGLDISNEATLAALTETLKASAAIGW
FT                   TAAPQLATGAASGETRPVVNPGDHRDRVGSVTETSEEDAKRAVRLAAEAAPSWAAVSPA
FT                   ERAACLDRAADLMQARMPTLLGLIVREAGKSLLNAIAEVREAIDFLRYYAEQTRRTLGQ
FT                   AHRPLGPVICISPWNFPLAIFTGQIAAALVAGNPVLAKPAEETPLIAAEGVRILHEAGV
FT                   PASALQLLPGDGRVGAALVAAPQTAGVMFTGSTEVARLIQAQLADRLSPAGRPIPLIAE
FT                   TGGQNAMIVDSSALAEQVVGDVIASAFDSAGQRCSALRVLCLQEDIADRTLAMLKGALH
FT                   ELNIGRTDRLSVDVGPVISAEAKDIIETHIERMRGLGRKVEQIGLAAETEAGTFVPPTI
FT                   IELEKLADLQREVFGPVLHVIRYRRDNLDRLIDDINATGYGLTFGLHTRLDETIAHVTS
FT                   RIKAGNLYVNRNIIGAVVGVQPFGGRGLSGTGPKAGGPLYLGRLVTPAPVPPQHSSVHI
FT                   DPTLLDFAKWLDGKGATAEAETARNAGSSSALGLDLELPGPVGERNLYALHPRGRVLLV
FT                   PATESGLYHQLAAALATGNSVVVDAACGLQASLKSLPHSVALRVSWSKDWAADGPFAGA
FT                   LVEGDAERIRQVNKAIAALPGPLVLVQAASGEEIARNPDAYCLNWLVEEVSTSINTAAA
FT                   GGNASLMTIG"
     atgagccaga cccagcttca aaaaccaacc attagcaccg acgccgcgcc cgcgcccttt        60
     gccgactttg cgccgccgat ccggacgcag accaccctgc gccaggcgat caccgccgcc       120
     tatcgccggc ccgagacgga atgcctgccg ccgctcgtcg aagccgcgac actgccgcgg       180
     ggaacgcggg acgccgccgc cgggaccgcc cgcaagctgg tcgaggcact gcgcgccaaa       240
     cacaagggtt cgggcgtcga ggggctggtg caggaatatt cgctttcgag ccaggagggc       300
     gtggcactca tgtgtcttgc cgaggcgctg ctgcgcatac ccgacacggc tacccgcgac       360
     gcgctgatcc gcgacaagat ctccgacggc aactggaagt cgcatctcgg cggcggccgg       420
     tcgctgttcg tcaacgccgc cacctggggt ctcgtcgtca ccggcaagct aacctcgacg       480
     gtcaacgacc gcagcctcgc cgcggcgctg acacggctga tctcgcgctg cggcgagccg       540
     gtgatccgac gcggcgtcga catggcgatg cggatgatgg gcgagcaatt cgtcaccggc       600
     gagacgatcg acgaggcgct gcgccgcgcc cgcgcgctcg agcagaaggg cttccgctat       660
     tcctacgaca tgctcggcga agcggcgacg accgccgccg acgcggagcg ctactacaag       720
     gactatgagg cggccatcca cgcgatcggc aaggcctctg ccggacgcgg catctatgaa       780
     ggtcccggca tctcgatcaa gctctccgcg ctccatcccc gttatgcgcg gacacaggcg       840
     gcgcgggtga tgggcgaatt gttgcccaag gtgaaggccc tcgccctcct cgccaagaca       900
     tacgacatcg gcttcaacat cgatgccgaa gaggccgacc ggctggaact gtcgctcgat       960
     cttctggagg aactctgcct cgacagcgat ctcgccgact ggaacggcat gggcttcgtc      1020
     gtgcaggcct atggcaagcg ttgccccttc gtgctcgact tcatcatcga cctggcccgc      1080
     cgtgccggcc ggcgcatcat ggtgcggctc gtcaagggcg cctattggga cgccgagatc      1140
     aagcgggcgc aactcgacgg gctcgaggat ttcccggtct tcacccgcaa gatccacacc      1200
     gacgtttcct acatcgcctg cgcccgcaag ctgctttcgg cgaccgacgc ggttttcccg      1260
     caattcgcca cgcacaacgc ccagacgctc gccaccatcc accacatggc cggcaaggac      1320
     tttcacgtcg gcaagtacga gttccagtgc ctgcacggca tgggcgagcc gctctacgaa      1380
     gaggtggtgg gacgggaaaa tctcggccgg ccctgccgca tctatgcgcc ggtcggcaca      1440
     cacgagacgc tgcttgccta tctcgtccgc cgcctgctcg agaacggcgc caactcctcc      1500
     ttcgtgcatc gcatcgccga tccgggcgtt tcgatcgacg cgttgatcgc cgatccggtg      1560
     gagatcgtcc gcgccatgcc ggtcgtcggc gccaagcacg agaagatagc gctgccggcc      1620
     gagctgttcg gagccgcgcg gccgaattcc gccggcctcg acatatccaa tgaagcgacc      1680
     cttgccgcct tgaccgagac gctcaaggca agcgccgcga tcggctggac cgcggccccg      1740
     caacttgcaa ccggcgcggc ttccggcgaa acgcgccctg tcgtcaatcc gggcgaccat      1800
     cgcgaccgcg tcggctcggt cacggagacg tccgaggaag acgcgaagcg ggccgtgcgg      1860
     cttgccgccg aggcggctcc gagttgggct gccgtttccc ccgccgaacg ggcggcctgc      1920
     ctcgaccgcg ccgccgattt gatgcaggcg cgcatgccga cgctcctcgg gctgatcgtg      1980
     cgcgaggcag gcaagtcgtt gctgaacgcg attgccgagg tgcgcgaggc gatcgatttc      2040
     ctgcgctatt acgccgaaca gacgcgccgg acccttggcc aggcccaccg gccgctcggt      2100
     cccgtcatct gcatcagccc gtggaacttt ccgctggcaa tcttcaccgg ccagatcgcc      2160
     gccgcactcg tcgccggcaa cccggtactg gccaagccgg cggaagaaac gccgctgatc      2220
     gccgccgaag gcgtgcgcat cctgcacgag gccggcgtgc cggcaagcgc cctgcagctc      2280
     ctgccgggcg acggccgcgt cggcgccgct ctggtcgcgg caccgcagac cgccggcgtg      2340
     atgttcaccg gctcgacgga ggtggcgcgg ctcatccagg cgcagctcgc cgatcggctc      2400
     tcgccggccg gccggccgat cccgctcatt gccgaaaccg gcggccagaa cgcgatgatc      2460
     gtcgattcct cggcgcttgc agaacaggtc gtcggcgatg tcatcgcctc ggccttcgac      2520
     agtgccggcc agcgctgctc ggcgctgcgc gtcctctgcc tgcaggagga catcgccgat      2580
     cgcacgctcg ccatgctgaa gggggcgctg cacgaattga acatcggccg caccgatcgt      2640
     ctttcagtgg atgtcggccc ggtgatctcc gccgaggcca aggacatcat cgagacgcac      2700
     atcgagcgga tgcgcgggct cggccgcaag gtggagcaga tcggccttgc cgccgagacg      2760
     gaagctggca ccttcgtgcc gccgacgatc atcgaattgg agaagctcgc cgatttgcag      2820
     cgcgaggtgt tcgggccggt gctgcatgtc atccgctacc gccgcgacaa tctcgatcgg      2880
     ctgatcgacg acatcaacgc caccggctac gggctgacct tcggcctgca cacgcggctc      2940
     gacgagacga tcgcccatgt gacgagccgc atcaaggccg gcaacctcta tgtcaaccgc      3000
     aacatcatcg gcgcggtggt gggagtccaa cccttcggcg gccgcggcct ttccggcacc      3060
     ggtccgaagg ccggcggacc gctctatctc ggccggctgg taacgccggc cccggtgccg      3120
     ccgcagcaca gctccgtgca tattgacccg acgctgctcg atttcgccaa gtggctcgac      3180
     ggcaagggtg cgacggcgga ggcggagaca gcccgcaatg ccggcagcag ctcagcgctg      3240
     ggactggacc tcgaactccc cggcccggtc ggcgagcgca acctctatgc actgcatccg      3300
     cgcggccgtg tcctgcttgt gccggcgacc gagagcgggc tttaccacca gctcgccgca      3360
     gcgcttgcaa ccggcaacag cgtcgtcgtc gatgccgcct gcggcctgca ggcctcgctg      3420
     aagtccctgc cgcacagtgt ggccctgcgc gtctcctggt cgaaggactg ggccgccgac      3480
     ggcccgttcg ccggtgccct ggtcgaaggc gacgccgagc gcatccgcca agtcaacaag      3540
     gcaattgcgg cattgcccgg tccgctcgtg ctggtccagg ccgcctcggg cgaggagatc      3600
     gcccgcaatc cggacgccta ttgcctgaac tggctggtcg aggaggtttc cacctcgatc      3660
     aacacggccg ccgccggcgg caatgccagc ctgatgacaa tcggctga                   3708
//

If you have problems or comments...

PBIL Back to PBIL home page