(data stored in ACNUC7421 zone)

EMBL: CP001389.RBSA2

CP001389.RBSA2       Location/Qualifiers
FT   CDS_pept        287643..289154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsA2"
FT                   /locus_tag="NGR_c02460"
FT                   /product="ribose import ATP-binding protein RbsA1"
FT                   /EC_number="3.6.3.17"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02460"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24044"
FT                   /db_xref="GOA:C3MFZ3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFZ3"
FT                   /protein_id="ACP24044.1"
FT                   /translation="MKPAITLEGISKSFPGVRALSDVSLALYPGSVTALIGENGAGKST
FT                   LVKILTGIYQPDSGMIRVADTETTFPTALAAARAGVTAIHQETVLFDELSVAENIFLGH
FT                   APRNRFGLIDWKKLNADAAALLQRAGADFDPTIRLRDLGIAKKHLVAIARALSVDAQVV
FT                   IMDEPTAALSHKEIHELYALIERLKADGKAILFISHKFDEIFRIADRYTVFRDGTMVGE
FT                   GLIADASQDDLVRMMVGRAVDSVYPKKDVKIGEAVLTVSGYRHPTEFEDINFELRRGEI
FT                   LGFYGLVGAGRSEFMQSLIGITRPSAGAVRLDGNVLVIRNPAEAIRAGIVYVPEERGRQ
FT                   GAIIGMPIFQNVTLPSLSHTSRSGFLKLANEFALAREYTARLDLRAASLDQDVGTLSGG
FT                   NQQKVVIAKWLATKPKVIILDEPTKGIDIGSKAAVHAFMSELAAQGLSVIMVSSEIPEI
FT                   MGMSDRVIVMREGRIAGRFERSELTAEKLVRAAAGIETQINGRAA"
     atgaagcccg ccatcactct cgagggcatt tcgaagtcct tcccgggtgt gcgggctctc        60
     tccgatgtct ctctcgcgct ctatccgggt tcggtaacgg cgctgatcgg cgaaaacggc       120
     gccggcaaat cgacgctcgt caagatcctg accggcatct atcagccgga ttccggcatg       180
     atccgggtcg ccgacacgga aacgacattc cccaccgccc tcgccgcggc gcgcgccggg       240
     gtgaccgcga tccatcagga aacggtgctc ttcgacgagc tttcggttgc ggaaaacatc       300
     ttcctcggcc atgccccgcg caaccgcttc ggtttaatcg actggaagaa gctgaacgcc       360
     gacgccgcgg ccctgctgca gcgggccggc gccgatttcg acccgacgat ccggctgcgc       420
     gacctcggca tcgccaagaa gcatctggtg gcgatcgccc gtgcgctctc cgtcgatgcg       480
     caggtcgtca tcatggatga gccgacggcg gcgctgtcgc acaaggaaat ccatgagctc       540
     tacgccctga tcgagcggct caaggccgac ggcaaggcga tcctcttcat cagccacaag       600
     ttcgacgaaa tcttccggat cgccgatcgt tataccgtct tccgcgacgg aacgatggtc       660
     ggcgaagggc tgatcgccga cgccagccag gatgatctcg tccgcatgat ggtcggccgt       720
     gcggtcgatt ccgtctaccc gaagaaggac gtcaagatcg gcgaggcggt gctgacggtc       780
     tccggctacc gccatccgac cgaattcgag gacatcaatt tcgagctgag gcgcggcgaa       840
     atcctcggct tctacggtct cgtcggggcc gggcgctcgg aattcatgca gtcgctgatc       900
     ggcatcaccc gcccgtcggc cggtgcggtc aggctggatg gaaatgtgct ggtcatccgc       960
     aacccggccg aggcgatccg tgccggcatc gtctatgtcc ccgaagagcg cggccggcag      1020
     ggcgctatca tcggcatgcc gatcttccag aacgtcacat tgccgtcgct atcgcacacc      1080
     tcgcgctcgg gtttcctgaa gctcgccaac gagttcgccc tggcgcgcga atacaccgcg      1140
     cgcctcgatc tgcgcgccgc ctcgctcgat caggacgtcg gcacgctctc cggcggcaac      1200
     cagcagaagg tggtgatcgc caagtggctg gcgaccaagc ccaaggtcat catcctcgac      1260
     gagccgacca aaggcatcga catcggctcc aaggccgccg tgcacgcctt catgagcgaa      1320
     ctcgcggcgc agggcttgag cgtcatcatg gtctcctcgg aaatccccga gatcatgggc      1380
     atgtccgacc gggtcatcgt catgcgcgaa ggccggatcg ccggccgctt cgaacgctcc      1440
     gaactgacgg ccgagaagct ggtgcgcgcc gcggccggca tcgaaacgca gatcaacggg      1500
     agggccgcat ga                                                          1512
//

If you have problems or comments...

PBIL Back to PBIL home page