(data stored in ACNUC7421 zone)

EMBL: CP001389.RIBA

CP001389.RIBA        Location/Qualifiers
FT   CDS_pept        577607..578707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribA"
FT                   /locus_tag="NGR_c05210"
FT                   /product="riboflavin biosynthesis protein"
FT                   /EC_number="3.5.4.25"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05210"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24317"
FT                   /db_xref="GOA:C3MHI9"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHI9"
FT                   /protein_id="ACP24317.1"
FT                   /translation="MSYDQKRVVEAIRAFEAGEIVVVTDDGGRENEGDLIVAAVHCTSE
FT                   KMAFIVRHTSGIVCAPMPRDEAKRLNLNAMVAENDSAHTTAFTVSVDFKHGTTTGISAD
FT                   DRTLTVRNLANPNVGATDFVRPGHIFPLVAREGGVLMRSGHTEAAVDLCKLASLPPIGV
FT                   ICELVNDDGTVTRGPQVEAFAETHGLKQVSVADLIAYRQRKETLIEKANSFAIETAYGR
FT                   AKAHTYSLPWDPMQHLAVVFGDVRDGVDIPVRLHLENVGADVFGNDRQIDEIMKRIAGE
FT                   GRGVIVYLREGSVGVGVSQTARKGKHEREAHSEAQARESEWLEIGLGAQILKDLGITSI
FT                   RLLSSRERHYVGLEGFGIKIAATEIL"
     atgtcctatg accagaagcg cgtcgtcgag gccattcgcg ctttcgaggc cggcgagatc        60
     gtcgtcgtca ccgatgacgg cgggcgcgag aacgagggcg acctgatcgt tgcggcggtg       120
     cactgcacgt ccgagaagat ggccttcatc gtcaggcaca cctcgggcat cgtctgtgcg       180
     ccgatgccgc gcgacgaggc caaacgcctc aacctgaatg cgatggtcgc cgagaacgat       240
     tccgcccaca ccacggcctt cacggtttcc gtcgatttca agcacgggac gaccaccggc       300
     atttctgccg acgatcgaac cttgactgtg agaaaccttg ccaatccgaa tgtcggagcg       360
     acggatttcg tgcggcccgg ccatatcttt ccgctggtgg cgcgcgaggg cggcgtgttg       420
     atgcgctccg gccacaccga ggcggccgtc gacctgtgca agctcgccag cctgccgccg       480
     atcggcgtca tctgcgaact cgtcaatgac gacggcaccg tgacacgcgg tccgcaggtg       540
     gaggcattcg ccgaaacgca cggtttgaag caggtctccg ttgccgacct catcgcctac       600
     cgccagcgca aggagaccct gatcgagaag gccaacagct tcgcgatcga gacggcctac       660
     ggccgggcga aggcccatac ctattcattg ccctgggacc cgatgcagca tctcgccgtc       720
     gttttcggcg acgttcgcga cggcgtcgat attcccgttc gcctccacct cgagaatgtc       780
     ggcgcggacg tcttcggcaa cgatcgccag atcgacgaga tcatgaagcg cattgccggc       840
     gagggcaggg gtgtcatcgt ctatctgcgc gaaggctcgg tcggcgtcgg cgtctcgcag       900
     acggcgcgaa agggcaagca tgaacgcgag gcccattcgg aagcgcaggc gcgcgaaagc       960
     gaatggctgg aaatcggtct cggcgcccag atcctcaagg atctcggcat cacctccatc      1020
     cgcctcctct catcccgcga gcgccactat gtcggcctcg aaggcttcgg catcaagatt      1080
     gccgcgaccg aaatactgta g                                                1101
//

If you have problems or comments...

PBIL Back to PBIL home page