(data stored in ACNUC7421 zone)

EMBL: CP001389.RIBF

CP001389.RIBF        Location/Qualifiers
FT   CDS_pept        461570..462640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribF"
FT                   /locus_tag="NGR_c04130"
FT                   /product="riboflavin biosynthesis protein RibF"
FT                   /EC_number="2.7.1.26"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04130"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24209"
FT                   /db_xref="GOA:C3MGU4"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGU4"
FT                   /protein_id="ACP24209.1"
FT                   /translation="MTVFHRNETRDPLPERLHGGVIAIGNFDGVHRGHQSVLNRALDEA
FT                   KGRGVPALVLTFEPHPRTVFRPDQPVFRLTPAPLKARILEGMGFGAVIEYPFDRTFSEL
FT                   SASRFHPPHPARMAARLTCRHRFRFPFWQGAGRRSGLPDGGRLEGRLRRDAGGRLPRRE
FT                   RLRHFFELHPLLAGRRRCLACGRHARLSLHGRSGGDRRQEARAHPRLSDREHAPTAGSR
FT                   TPKRHLCGALPPSGRFSLRRRRKLRPPSDRRQRWRSAAGDLRLRLLRRSLRRGLRRLLL
FT                   WASARRAEIRRAGAFDGAYERGREGGACPSCRRSAFERDRPPDQFRLRWAREAVCWRKE
FT                   SRHAALADLFKRPKTP"
     atgacggttt ttcatcgcaa cgagacccgt gatccgcttc ccgaacgtct ccacggcggc        60
     gtgatcgcga tcggcaattt cgacggcgtc caccggggcc accagtcggt gctgaaccgc       120
     gcgctcgacg aggcaaaggg ccggggcgtt ccggctctcg tgctgacctt cgaaccgcat       180
     ccgcgcaccg tcttccggcc cgaccagccc gtgttccgcc tgaccccggc gccgctgaag       240
     gcccgcatcc tcgaagggat gggttttggc gccgtgatcg aatatccctt cgatcggacc       300
     ttttcggaac tgtcggcctc ccgatttcat ccaccgcatc ctgcgcgaat ggctgcacgc       360
     ctcacatgtc gtcaccggtt tcgatttcca ttttggcaag gggcgggaag gcggtccggc       420
     cttcctgatg gcggccggct cgaaggaagg cttcggcgtg acgctggtgg acgccttccg       480
     cgacgagaac gcctccgtca tttcttcgag cttcatccgc tccttgctgg ccgaaggcga       540
     tgtctcgcat gcggccggca tgctcggcta tcgctacacg gtcgaagcgg aggtgatcgg       600
     cggcaagaag ctcgggcgca ccctcggcta tccgaccgcg aacatgcgcc taccgcagga       660
     agccgaactc cgaaacggca tctatgcggt gcgcttccgc cgagcggacg gttctcttta       720
     cgacggcgtc gcaagcttcg gccgccgtcc gaccgtcgac agcgatggag aagcgctgct       780
     ggagaccttc gtcttcgact tctccggcga tctctacggc gaggtctgcg ccgtctcctt       840
     ctttgggcat ctgcgcgacg agctgaaatt cgacgggctg gagcctttga tggcgcatat       900
     gagagaggac gagaaggagg cgcgtgccct tcttgccggc gttcagcctt tgagcgagat       960
     cgaccgccag atcaatttcg cctgaggtgg gcgagggagg cagtatgctg gcgcaaagaa      1020
     tcgcgccatg ctgcgctcgc ggaccttttc aaaaggccga aaacgcctta a               1071
//

If you have problems or comments...

PBIL Back to PBIL home page