(data stored in ACNUC7421 zone)

EMBL: CP001389.RIMJ

CP001389.RIMJ        Location/Qualifiers
FT   CDS_pept        complement(596277..596888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimJ"
FT                   /locus_tag="NGR_c05410"
FT                   /product="ribosomal-protein (S5)-alanine
FT                   N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05410"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24337"
FT                   /db_xref="GOA:C3MHK9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHK9"
FT                   /protein_id="ACP24337.1"
FT                   /translation="MARSVFRFLSRQPESVEIANEDYLLRLPRYADYRQWYQLRSASRS
FT                   FLEPWEPSWRTDEMTESAFRGRVIRNEQEFASGQAVPLFLFHKHDEVLLGGLTIGHIRR
FT                   GAAQNCMIGYWMGQKYAGQGHMHAALQLTIPYIFSTLELHRIEAACIPENTRSIRLLEK
FT                   AGFEREGYLRQYLKINGQWRDHLMFSLLSADAVPSRNMPL"
     atggcgcgat cggtgtttcg gttcctgtcc cggcagcccg aatcggtcga gatcgccaac        60
     gaggactacc ttcttcgcct cccgcgctat gccgactatc ggcaatggta tcaattgcgc       120
     agcgcaagcc gcagctttct ggaaccgtgg gaaccgtcct ggcgcaccga tgagatgacc       180
     gaaagcgcgt ttcgcggccg cgtcattcgc aacgaacagg aattcgcttc cggccaggcg       240
     gtgccgctgt tccttttcca caaacacgac gaggtcctcc tcggcggtct gacgatcggc       300
     catatccgcc ggggtgccgc gcagaactgc atgatcggct actggatggg gcagaaatat       360
     gccggccagg gccacatgca cgcagccctg cagctgacga tcccctacat cttttcgacc       420
     ctcgagttgc accgtatcga agcagcctgt attccagaaa acacacggag cattcggctc       480
     cttgaaaagg ccggctttga acgcgaaggc tacttgagac agtacttgaa gataaacggc       540
     cagtggcgcg atcacctgat gttttcgctt ctgtccgcgg atgccgtacc gagcaggaat       600
     atgccccttt ga                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page