(data stored in ACNUC7421 zone)

EMBL: CP001389.RNPA

CP001389.RNPA        Location/Qualifiers
FT   CDS_pept        complement(88738..89124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnpA"
FT                   /locus_tag="NGR_c00830"
FT                   /product="ribonuclease P protein component"
FT                   /EC_number="3.1.26.5"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00830"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23887"
FT                   /db_xref="GOA:C3MF50"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF50"
FT                   /protein_id="ACP23887.1"
FT                   /translation="MTSEKDKSTVGRLKSRPQFLAVRAGEARKGPHFLLEVLDRKDPEG
FT                   EARVGFTVTKKHGNAVERNRMRRRLKEAVRLSAGFAMKPGHDYVIVARRDLLNAPFDAL
FT                   TRGLQDRIENKPKPKRPPAGSRKP"
     atgacgtcag aaaaagacaa gtccactgtc ggacggctga aaagccgtcc gcagtttttg        60
     gcggtcaggg cgggagaagc ccgaaaaggg ccgcactttc tccttgaagt gcttgaccgg       120
     aaggatccgg agggcgaggc ccgcgtcggc ttcactgtta ccaagaaaca cggcaatgcc       180
     gtcgagcgaa accggatgcg ccgacgcctc aaagaggccg tacggctttc cgccgggttt       240
     gcaatgaaac ccggacacga ctatgtgatt gtcgcccgac gcgatctcct gaacgcgcct       300
     tttgacgcat tgacccgagg cttgcaggat cgcatcgaaa acaagccgaa accgaagcgg       360
     ccgccggccg gttccaggaa accatga                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page