(data stored in ACNUC7421 zone)

EMBL: CP001389.SECD1

CP001389.SECD1       Location/Qualifiers
FT   CDS_pept        225770..228307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secD1"
FT                   /locus_tag="NGR_c02010"
FT                   /product="protein-export membrane protein SecD/SecF"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02010"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24001"
FT                   /db_xref="GOA:C3MFV0"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFV0"
FT                   /protein_id="ACP24001.1"
FT                   /translation="MRTSRWAVLAYVAIIIFGCLAAVPSVLTPAMREQFASVLPFKPVT
FT                   LGLDLRGGSHLVLEVDGAGLQKARLNSLLDDTRRVLRGERVSASSARISGNSVTVSVPD
FT                   PADREKVLPKLQELAAPVGGTAGFGGSAAEVDVATNGDVITLAMTEAGLADRMTKAVEQ
FT                   SLEIIRNRVDQVGVAEPLIQRIGSNRILVQLPGLQDPTRLRELLGSTAQMSFHMLDQTV
FT                   DITQPAPRGVDILPGADDGNKYPVESRVAISGERLEDAKVGFDQRTNQPVVDFAFDSLG
FT                   ARQFADITRENVGRPFAIVLDGKVLTAPVINEPILGGRGQISGNFTVEEATVLSALLRS
FT                   GALPAPLTIIEERSVGPNLGSDSIRMGLYTGLAGFGLVVTLMVVLYGAWGMIANVGLVL
FT                   HTIMTIGVLGLIGSTLTLPGIAGIILGIGMAVDANILINARIREETEAGAGAMKALDVG
FT                   FNKAYATILDSNVTTLAGTILLFWLGSGPVRGFAVTMMLGIIISMFTSVTVVRLLMREV
FT                   VVRRKMKKLEIPSLFGRVPHLPTFSFMKRRFQAIGFSAFLSISSVILFFTPGLNYGIDF
FT                   IGGIQVEAVSKDKIDLPTLRHSLEELNLGEVALQDFGGGQSVLVRVQRQPGGEQEQTAA
FT                   LNRIKDAVTTAIPGASMERTEVVGPTVSGELARSGFLAVGLAMVAILLYIWFRFEWHFA
FT                   VGAIAVLLLDITKTVGFFALTGIDFNLTAIAALLTMIGYSVNDKVVVYDRMRENLRKYK
FT                   SMPFSDLIDMSINQVIARCIFTSMATALSLVPMAIWGGEAVRSFAWPMIFGVIVATTSS
FT                   IYIGGPILLFLSRWWKDREAGRSSAQQPGTPAV"
     atgcgtacat ccagatgggc ggttctcgcc tatgtcgcga tcattatctt cggatgcctc        60
     gcggccgtgc cgagcgtgtt gacgccggcc atgcgggagc aattcgcttc cgtccttccc       120
     ttcaagccgg tcaccctcgg cctcgacctt cgcggcggtt cgcacctcgt gctcgaggtc       180
     gacggggccg ggctgcagaa ggctcgcctc aactcgcttc tcgacgacac ccggcgcgtc       240
     ctgcgcggcg agcgcgtctc ggcctcttcg gcgcgcatca gcggcaacag cgtgacggta       300
     agcgtcccgg atccggcgga ccgcgaaaag gtgctgccga agctgcagga gctggcggct       360
     cccgtcggcg gcacggccgg tttcggcggc tccgctgccg aggtcgatgt ggcgacgaat       420
     ggcgacgtca tcacgctcgc catgacggag gcaggccttg ccgaccgtat gaccaaggcg       480
     gtcgagcaga gccttgaaat catccgcaac cgcgtcgacc aggtcggcgt cgccgagcca       540
     ctgatccagc gcatcggttc gaaccgcatt ctcgtccagc tgccggggct ccaggatccg       600
     acgcgtctgc gcgagctgct cggttcgacc gcgcagatga gcttccacat gctcgaccag       660
     accgtcgaca tcacgcagcc ggctccgcgc ggcgtcgata tcctgccggg cgccgatgac       720
     ggcaacaaat atccggtcga aagccgcgtc gcgatttccg gcgaacgcct cgaggatgcc       780
     aaggtcggct tcgaccagcg caccaaccag ccggtggtgg atttcgcctt cgactcgctc       840
     ggcgcccgcc agttcgccga tatcacccgc gaaaacgtcg gccgtccctt tgccatcgtc       900
     ctcgacggca aggtcctgac cgctccggtc atcaacgagc cgatcctcgg cggccgcggc       960
     caaatcagcg gcaacttcac cgtcgaggag gcaacggtcc tctcggcgct gctgcgctcc      1020
     ggagccttgc cggcgccgct caccatcatc gaagagcgct ccgtcggtcc gaacctcggc      1080
     agcgactcga tccgcatggg tctctatacc ggtctcgccg gtttcggcct cgtcgtgacg      1140
     ctgatggtgg tcctttacgg tgcctggggc atgatcgcca atgtcggcct ggtgctccac      1200
     accatcatga cgatcggcgt tctcggcctg atcggttcga cgctgacctt gccgggcatc      1260
     gccggtatca tcctcggcat cggcatggcg gtcgacgcca acatcctcat caacgcgcgt      1320
     atccgcgaag agacggaagc gggcgctggt gcgatgaagg cgctcgatgt cggcttcaac      1380
     aaggcctatg cgaccatcct cgattccaac gtcaccacgc ttgccggcac gatactcctc      1440
     ttctggctgg gcagcggtcc ggtccgcggc ttcgcggtca cgatgatgct cggcatcatc      1500
     atctcgatgt tcacttcagt gacggtcgtg cgcctgctga tgcgcgaggt cgtcgtgcgc      1560
     cgcaagatga agaagctgga gatcccgtcg ctctttgggc gcgtcccgca tctgccgacc      1620
     ttctccttca tgaagcggcg cttccaggcg atcggctttt cggccttcct gtcgatcagc      1680
     tcggtcatcc tgttcttcac gcccggcctc aactacggca tcgacttcat cggcggtatc      1740
     caggtcgagg cggtatcgaa ggacaagatc gacctgccga cgctgcgcca cagtctcgaa      1800
     gagctcaatc tcggcgaggt ggcgctgcag gacttcggcg gcggccagtc ggtactggtt      1860
     cgcgtccagc gccagccggg cggcgagcag gagcagacgg cggcgctgaa ccgcatcaag      1920
     gatgcggtga cgaccgccat ccccggcgcc agcatggagc gtacggaggt cgtcggtccg      1980
     acggtcagcg gcgagctggc ccgttcgggc ttcctcgctg tcggcctcgc gatggtggcg      2040
     atcctgctct acatctggtt ccgcttcgaa tggcacttcg ccgtcggcgc gatcgcggtg      2100
     ctgttgctcg atatcaccaa gaccgtcggc ttctttgcgc tgacgggcat cgacttcaac      2160
     ctgacggcga tcgccgctct gctgacgatg atcggctact cggtgaacga caaggtggtg      2220
     gtctacgacc gcatgcgcga gaacctgcgc aagtacaagt cgatgccgtt ctccgacctc      2280
     atcgacatga gcatcaacca ggtgatcgcg cgatgcatct tcacctccat ggcgacggcg      2340
     ctttcactgg tgccgatggc catctggggc ggcgaggcgg tgcgcagctt cgcctggccg      2400
     atgatcttcg gcgtcatcgt cgcgacgacc tcgtcgatct acatcggcgg accgatcctc      2460
     ctgttcctca gccgttggtg gaaggatcgc gaggccggcc gctccagcgc gcagcagccg      2520
     ggcacgccgg cggtctga                                                    2538
//

If you have problems or comments...

PBIL Back to PBIL home page