(data stored in ACNUC7421 zone)

EMBL: CP001389.SPPA

CP001389.SPPA        Location/Qualifiers
FT   CDS_pept        19002..19961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sppA"
FT                   /locus_tag="NGR_c00210"
FT                   /product="signal peptide peptidase S49, SppA"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00210"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23825"
FT                   /db_xref="GOA:C3MEK2"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEK2"
FT                   /protein_id="ACP23825.1"
FT                   /translation="MDELAIADRRSLRRKLSFWRWTAAAILVLGGFALIAFSGWTEVSE
FT                   RAREHVARVTVSGVIQDDRELVERLERIADNKSAKALIVTISSPGGTTYGGEVLYKAIR
FT                   KVAAKKPVVSDVRTLAASAGYMIALAGDRIVAGETSITGSIGVIFQYPQVKQLMDKVGV
FT                   SLESIKSRPLKAEPSPFHPPSPEARAMIQTMIDDSYNWFVDLVAERRKLPRPEALALAD
FT                   GRIFTGRQALQGKLVDTIGGDDEIRAFLADRKVSKDLPVVDWEAPGGSFPFGLSTVVSN
FT                   WLKLLGYDAFPAMNGLEKIGGDKLFLDGLVSVWQVDAQ"
     atggacgaac tcgccattgc cgatcgccgc agcctgcgca ggaagctgag cttctggcgc        60
     tggacggccg ctgccattct cgtcctgggc ggtttcgcgc tcattgcctt ttccggctgg       120
     accgaggtca gcgaacgggc tcgcgagcac gttgcccgcg tcaccgtttc cggcgtcatc       180
     caggacgacc gggaactggt cgagaggctg gagaggattg ccgacaataa atccgccaag       240
     gcgctgatcg tgacgatatc gtcgccgggg ggcaccacct atggcggcga ggtgctctat       300
     aaggcgatcc gcaaggtcgc agccaagaag ccggtggtct ccgatgtccg gacgctcgcc       360
     gcctcggccg gctacatgat agcgctcgct ggcgatcgca tcgtcgccgg ggaaacctcg       420
     atcaccggtt cgatcggcgt catcttccaa tatccgcagg tcaagcaact gatggacaag       480
     gtcggcgtgt cgctggagtc gataaagtcg cggccgttga aggccgagcc ctctccattc       540
     catccgccga gcccggaggc gcgggcgatg atccagacga tgatcgacga cagctacaac       600
     tggttcgtcg atctggtggc cgaacggcgc aagctgccgc ggccggaggc gctggcgctg       660
     gccgatggcc gcatcttcac cggacgtcag gccctgcagg gcaagctcgt cgataccatc       720
     ggcggagacg acgagatcag ggctttcctc gccgatcgca aggtgtcgaa ggacctgccc       780
     gtggtggatt gggaagcgcc gggcggttcc ttccctttcg ggctttcgac ggtcgtctcc       840
     aactggctca agctgttggg atatgatgct tttccagcga tgaacggact tgaaaagatc       900
     ggcggcgaca agttgtttct tgacggtctt gtttcggttt ggcaggttga tgctcaataa       960
//

If you have problems or comments...

PBIL Back to PBIL home page