(data stored in ACNUC7421 zone)

EMBL: CP001389.THRB

CP001389.THRB        Location/Qualifiers
FT   CDS_pept        588209..589189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /locus_tag="NGR_c05340"
FT                   /product="homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05340"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24330"
FT                   /db_xref="GOA:C3MHK2"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR005280"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MHK2"
FT                   /protein_id="ACP24330.1"
FT                   /translation="MAVYTDITEDELAGFLAAYDVGTLTSYKGIAEGVENSNFLLHTTR
FT                   GSYILTLYEKRVNADDLPFFLGLMHHLAERGLSCPLPLPRADGALLGTLSGRPAAVISF
FT                   LEGMWLRKPEAQHCREVGRALASMHEAGEGFALTRANALSVGGWRPLWRNSEARADEVQ
FT                   DGLKEDIAAELAYLEDHWPRNLPQGVIHADLFPDNVFFLGDRLSGLIDFYFACNDFLAY
FT                   DIAVCLNSWCFEKNGSYNITKGMALLSGYESVRKLTAEEVSALPLLARGSALRFFLTRL
FT                   YDWLMTPAGALVVKKDPLEYLTKLRFHRAVVSSAEYGLRRDEASQ"
     ttggcagttt acaccgatat cacggaagac gagttggccg gctttctggc cgcctatgat        60
     gtgggaacgc tcacttccta caagggcatc gccgaaggcg tggagaactc gaacttcctt       120
     ctccatacga ccaggggctc ctatatcctg acgctttacg aaaagcgggt gaatgccgat       180
     gacctcccgt tcttcctggg gttgatgcac catctcgccg aacgcgggct gtcctgcccg       240
     ctgcccttgc cgcgcgctga tggcgcgctg ctcggcacgt tgtccggccg gccggccgcc       300
     gtcatctcct ttctcgaagg catgtggctg aggaagcccg aggcgcagca ttgccgtgaa       360
     gtcggccggg cgctcgcctc gatgcacgag gctggcgagg ggtttgcctt gacgcgggcc       420
     aatgcgctct ccgtcggcgg ctggcggccg ctctggcgga attccgaggc ccgcgccgac       480
     gaggtgcagg acggtctgaa ggaggacatc gcggcggagc tcgcctatct cgaagaccat       540
     tggccgcgaa acctgccgca gggcgtgatc catgcggatc tcttcccgga caacgtcttc       600
     ttcctcggcg atcgcctttc cggtctcatc gatttctact tcgcctgcaa cgatttcctc       660
     gcatacgata tcgccgtctg cctgaactcc tggtgcttcg agaagaacgg ctcctacaac       720
     atcaccaagg gaatggccct gctttccggt tacgagagcg tacgcaagct gacggcggag       780
     gaggtaagcg ccctgccgct gctggcgcgc ggctcggcgc tgcgcttctt cctgacgcgc       840
     ctctacgact ggctgatgac gccggccggc gcgctggtgg tcaagaagga cccgctcgaa       900
     tatctgacga agctccgctt ccatcgcgcc gtcgtatcga gcgccgaata cggcctgcga       960
     cgcgacgagg cttcgcaatg a                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page