(data stored in ACNUC7421 zone)

EMBL: CP001389.XSEB

CP001389.XSEB        Location/Qualifiers
FT   CDS_pept        complement(556026..556280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseB"
FT                   /locus_tag="NGR_c04980"
FT                   /product="exodeoxyribonuclease VII small subunit"
FT                   /EC_number="3.1.11.6"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04980"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24294"
FT                   /db_xref="GOA:C3MHG6"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHG6"
FT                   /protein_id="ACP24294.1"
FT                   /translation="MNNNNTQPDVSALSFEQAVEELERIVSALERGDVALDKSIEIYER
FT                   GEALKKHCETLLKAAEDRIEKIRLDRNGKPQAVEPLDAE"
     atgaacaaca acaatacgca gccggacgtc tccgccctct ccttcgagca ggcggtcgag        60
     gagctggaac ggatcgtctc cgcgctcgag cgcggcgacg tggcgctcga caagtcgatc       120
     gaaatctatg agcgcggcga agcgctgaag aagcattgcg agacgctgct gaaggcggcc       180
     gaggaccgga tcgagaaaat tcgcctcgac cgcaacggca aaccgcaagc ggtggagccg       240
     ctcgacgcgg aatag                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page