(data stored in SCRATCH3701 zone)

EMBL: CP001396.BSSR

CP001396.BSSR        Location/Qualifiers
FT   CDS_pept        780439..780822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bssR"
FT                   /locus_tag="BWG_0689"
FT                   /product="conserved protein"
FT                   /note="MG1655 equivalent: b0836"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ACR62447"
FT                   /protein_id="ACR62447.1"
FT                   /translation="MFVDRQRIDLLNRLIDARVDLAAYVQLRKAKGYMSVSESNHLRDN
FT                   FFKLNRELHDKSLRLNLHLDQEEWSALHHAEEALATAAVCLMSGHHDCPTVITVNADKL
FT                   ENCLMSLTLSIQSLQKHAMLEKA"
     atgttcgttg acagacagcg aatcgatctg ctgaaccggt tgatcgacgc acgcgttgac        60
     ctcgccgcat acgtgcaact gaggaaggca aaaggataca tgtccgtcag cgaaagcaat       120
     catctacgag ataacttttt taaactgaat cgcgaactgc acgataaatc gctgcggttg       180
     aatcttcatc tggatcagga agagtggagt gctcttcatc atgctgaaga agcattagcg       240
     acagccgcag tatgtttgat gagtgggcac catgattgcc cgactgttat taccgtcaac       300
     gccgataagc ttgaaaattg tctgatgagc ttaacgctga gtatccagag cctgcagaag       360
     cacgccatgc ttgagaaggc ctga                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page