(data stored in SCRATCH3701 zone)

EMBL: CP001396.CMR

CP001396.CMR         Location/Qualifiers
FT   CDS_pept        785864..787096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cmr"
FT                   /locus_tag="BWG_0695"
FT                   /product="multidrug efflux system protein"
FT                   /note="MG1655 equivalent: b0842"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ACR63810"
FT                   /protein_id="ACR63810.1"
FT                   /translation="MQNKLASGARLGRQALLFPLCLVLYEFSTYIGNDMIQPGMLAVVE
FT                   QYQAGIDWVPTSMTAYLAGGMFLQWLLGPLSDRIGRRPVMLAGVVWFIVTCLAILLAQN
FT                   IEQFTLLRFLQGISLCFIGAVGYAAIQESFEEAVCIKITALMANVALIAPLLGPLVGAA
FT                   WIHVLPWEGMFVLFAALAAISFFGLQRAMPETATRIGEKLSLKELGRDYKLVLKNGRFV
FT                   AGALALGFVSLPLLAWIAQSPIIIITGEQLSSYEYGLLQVPIFGALIAGNLLLARLTSR
FT                   RTVRSLIIMGGWPIMIGLLVAAAATVISSHAYLWMTAGLSIYAFGIGLANAGLVRLTLF
FT                   ASDMSKGTVSAAMGMLQMLIFTVGIEISKHAWLNGGNGLFNLFNLVNGILWLSLMVIFL
FT                   KDKQMGNSHEG"
     atgcaaaata aattagcttc cggtgccagg cttggacgtc aggcgttact tttccctctc        60
     tgtctggtgc tttacgaatt ttcaacctat atcggcaacg atatgattca acccggtatg       120
     ttggccgtgg tggaacaata tcaggcgggc attgattggg ttcctacttc gatgaccgcg       180
     tatctggcgg gcgggatgtt tttacaatgg ctgctggggc cgctgtcgga tcgtattggt       240
     cgccgtccgg tgatgctggc gggagtggtg tggtttatcg tcacctgtct ggcaatattg       300
     ctggcgcaaa acattgaaca attcaccctg ttgcgcttct tgcagggcat aagcctctgt       360
     ttcattggcg ctgtgggata cgccgcaatt caggaatcct tcgaagaggc ggtttgtatc       420
     aagatcaccg cgctgatggc gaacgtggcg ctgattgctc cgctacttgg tccgctggtg       480
     ggcgcggcgt ggatccatgt gctgccctgg gaggggatgt ttgttttgtt tgccgcattg       540
     gcagcgatct cctttttcgg tctgcaacga gccatgcctg aaaccgccac gcgtataggc       600
     gagaaactgt cactgaaaga actcggtcgt gactataagc tggtgctgaa gaacggccgc       660
     tttgtggcgg gggcgctggc gctgggattc gttagtctgc cgttgctggc gtggatcgcc       720
     cagtcgccga ttatcatcat taccggcgag cagttgagca gctatgaata tggcttgctg       780
     caagtgccta ttttcggggc gttaattgcg ggtaacttgc tgttagcgcg tctgacctcg       840
     cgccgcaccg tacgttcgct gattattatg ggcggctggc cgattatgat tggtctattg       900
     gtcgctgctg cggcaacggt tatctcatcg cacgcgtatt tatggatgac tgccgggtta       960
     agtatttatg ctttcggtat tggtctggcg aatgcgggac tggtgcgatt aaccctgttt      1020
     gccagcgata tgagtaaagg tacggtttct gccgcgatgg gaatgctgca aatgctgatc      1080
     tttaccgttg gtattgaaat cagcaaacat gcctggctga acgggggcaa cggactgttt      1140
     aatctcttca accttgtcaa cggaattttg tggctgtcgc tgatggttat ctttttaaaa      1200
     gataaacaga tgggaaattc tcacgaaggg taa                                   1233
//

If you have problems or comments...

PBIL Back to PBIL home page