(data stored in SCRATCH3701 zone)

EMBL: CP001396.GSIA

CP001396.GSIA        Location/Qualifiers
FT   CDS_pept        769711..771582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsiA"
FT                   /locus_tag="BWG_0682"
FT                   /product="fused predicted peptide transport subunits of ABC
FT                   superfamily: ATP-binding components"
FT                   /note="MG1655 equivalent: b0829"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ACR63231"
FT                   /protein_id="ACR63231.1"
FT                   /translation="MPHSDELDAGNVLAVENLNIAFMQDQQKIAAVRNLSFSLQRGETL
FT                   AIVGESGSGKSVTALALMRLLEQAGGLVQCDKMLLQRRSREVIELSEQNAAQMRHVRGA
FT                   DMAMIFQEPMTSLNPVFTVGEQIAESIRLHQNASREEAMVEAKRMLDQVRIPEAQTILS
FT                   RYPHQLSGGMRQRVMIAMALSCRPAVLIADEPTTALDVTIQAQILQLIKVLQKEMSMGV
FT                   IFITHDMGVVAEIADRVLVMYQGEAVETGTVEQIFHAPQHPYTRALLAAVPQLGAMKGL
FT                   DYPRRFPLISLEHPAKQAPPIEQKTVVDGEPVLRVRNLVTRFPLRSGLLNRVTREVHAV
FT                   EKVSFDLWPGETLSLVGESGSGKSTTGRALLRLVESQGGEIIFNGQRIDTLSPGKLQAL
FT                   RRDIQFIFQDPYASLDPRQTIGDSIIEPLRVHGLLPGKDAAARVAWLLERVGLLPEHAW
FT                   RYPHEFSGGQRQRICIARALALNPKVIIADEAVSALDVSIRGQIINLLLDLQRDFGIAY
FT                   LFISHDMAVVERISHRVAVMYLGQIVEIGPRRAVFENPQHPYTRKLLAAVPVAEPSRQR
FT                   PQRVLLSDDLPSNIHLRGEEVAAVSLQCVGPGHYVAQPQSEYAFMRR"
     ttgccacaca gtgatgaact tgatgccggt aatgtgctgg cggttgaaaa tctgaatatt        60
     gcctttatgc aggaccagca gaaaatagct gcggtccgca atctctcttt tagtctgcaa       120
     cgcggtgaga cgctggcaat tgttggcgaa tccggctccg gtaagtcagt gactgcgttg       180
     gcattgatgc gcctgttgga acaggcgggc ggtttagtac agtgcgataa aatgctgttg       240
     cagcggcgca gtcgcgaagt gattgaactt agcgagcaga acgctgcaca aatgcgccat       300
     gttcgcggtg cggatatggc gatgatattt caggagccga tgacatcgct gaacccggta       360
     tttactgtgg gtgaacagat tgccgaatca attcgtctgc atcagaacgc cagtcgtgaa       420
     gaagcgatgg tcgaggcgaa gcggatgctg gatcaggtac gcattcctga ggcacaaacc       480
     attctttcac gttatccgca tcaactctct ggcgggatgc gccagcgagt gatgattgcg       540
     atggcgctgt catgccgccc ggcggtgctg attgccgatg agccaaccac cgcgctggat       600
     gtcactattc aggcgcagat cctgcaatta atcaaagtat tgcaaaaaga gatgtcgatg       660
     ggcgttatct ttatcactca cgatatgggc gtggtggcag agattgccga tcgggtactg       720
     gtgatgtatc agggcgaggc ggtggaaacg ggtaccgtcg aacagatttt tcatgcaccg       780
     caacatcctt acacccgtgc gctgttagct gctgttccgc aacttggtgc gatgaaaggg       840
     ttagattatc cccgacgttt cccgttgata tcgcttgaac atccagcgaa acaggccccc       900
     cccatcgagc agaaaacggt ggtggatggc gaacctgttt tacgagtgcg taatcttgtc       960
     acccgtttcc ctttgcgcag cggtttgttg aatcgcgtaa cgcgggaagt gcatgccgtt      1020
     gagaaagtca gttttgatct ctggcctggc gaaacgctat cgctggtggg cgagtctggc      1080
     agcggtaaat ccactaccgg gcgggcgttg ctgcgcctgg tcgaatcgca gggcggcgaa      1140
     attatcttta acggtcagcg aatcgatacc ttgtcacccg gcaaacttca ggcattacgc      1200
     cgggatattc agtttatttt tcaggaccct tacgcttcgc tggacccacg tcagaccatc      1260
     ggtgattcga ttatcgaacc gctgcgtgta cacggtttat tgccaggtaa agacgcggct      1320
     gcacgcgttg cgtggttgct ggagcgcgtg ggcctgttac ctgaacatgc ctggcgttac      1380
     ccgcatgagt tttccggcgg tcagcgccag cgcatctgca ttgctcgcgc gttggcattg      1440
     aatccaaaag tgatcattgc cgacgaagcc gtttcggcgc tggatgtttc tattcgcggg      1500
     cagattatca acttgttgct cgatctccag cgtgatttcg gcattgcgta tctgtttatc      1560
     tcccacgata tggcggtggt agagcggatt agtcatcgtg tggcggtgat gtatctcggg      1620
     caaattgttg aaattggtcc acggcgcgcg gtcttcgaaa acccgcagca tccttatacg      1680
     cgtaaattac tggcggcagt tccggtcgct gaaccgtccc gacaacgacc gcagcgtgta      1740
     ctgctgtcgg acgatcttcc cagcaatatt catctgcgtg gcgaagaggt ggcagccgtc      1800
     tcgttgcaat gcgtcgggcc ggggcattac gtcgcacaac cacaatcaga atacgcattc      1860
     atgcgtagat aa                                                          1872
//

If you have problems or comments...

PBIL Back to PBIL home page