(data stored in SCRATCH3701 zone)

EMBL: CP001396.GSIB

CP001396.GSIB        Location/Qualifiers
FT   CDS_pept        771602..773140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsiB"
FT                   /locus_tag="BWG_0683"
FT                   /product="predicted peptide transporter subunit:
FT                   periplasmic-binding component of ABC superfamily"
FT                   /note="MG1655 equivalent: b0830"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ACR64803"
FT                   /protein_id="ACR64803.1"
FT                   /translation="MARAVHRSGLVALGIATALMASCAFAAKDVVVAVGSNFTTLDPYD
FT                   ANDTLSQAVAKSFYQGLFGLDKEMKLKNVLAESYTVSDDGITYTVKLREGIKFQDGTDF
FT                   NAAAVKANLDRASDPANHLKRYNLYKNIAKTEAIDPTTVKITLKQPFSAFINILAHPAT
FT                   AMISPAALEKYGKEIGFYPVGTGPYELDTWNQTDFVKVKKFAGYWQPGLPKLDSITWRP
FT                   VADNNTRAAMLQTGEAQFAFPIPYEQATLLEKNKNIELMASPSIMQRYISMNVTQKPFD
FT                   NPKVREALNYAINRPALVKVAFAGYATPATGVVPPSIAYAQSYKPWPYDPVKARELLKE
FT                   AGYPNGFSTTLWSSHNHSTAQKVLQFTQQQLAQVGIKAQVTAMDAGQRAAEVEGKGQKE
FT                   SGVRMFYTGWSASTGEADWALSPLFASQNWPPTLFNTAFYSNKQVDDFLAQALKTNDPA
FT                   EKTRLYKAAQDIIWQESPWIPLVVEKLVSAHSKNLTGFWIMPDTGFSFEDADLQ"
     atggcaagag ctgtacaccg tagtgggtta gtggcgctgg gcattgcgac agcgttgatg        60
     gcatcttgtg cattcgctgc caaagatgtg gtggtggcgg taggatcgaa tttcaccacg       120
     ctcgatccgt atgacgcaaa tgacacgtta tctcaggccg tagcgaaatc gttttaccag       180
     gggctgttcg gtctggataa agagatgaaa ctgaaaaacg tgctggcgga gagttatacc       240
     gtttccgatg acggcattac ttacaccgtg aaattgcggg aaggcattaa attccaggat       300
     ggcaccgatt tcaacgccgc ggcggtgaaa gcgaatctgg accgggccag cgatccggcg       360
     aatcatctta aacgctataa cctgtataag aatattgcta aaacggaagc gatcgatccg       420
     acaacggtaa agattaccct caaacagccg ttctcagcgt ttattaatat tcttgcccat       480
     ccggcgaccg cgatgatttc accggcagcg ctggaaaaat atggcaagga gattggtttt       540
     tatccggtgg gaaccggacc gtatgaactg gatacctgga atcagaccga ttttgtgaag       600
     gtgaaaaaat tcgcgggtta ctggcagcca ggattgccca aactggacag cataacctgg       660
     cgtccggtgg cggataacaa cacccgcgcg gcaatgctgc aaaccggtga agcgcagttt       720
     gctttcccca ttccttacga gcaggccaca ctgctggaga aaaacaaaaa tatcgagttg       780
     atggccagtc cgtcaattat gcagcgttat atcagtatga acgtgacgca aaagccgttc       840
     gataacccga aggtccgtga ggcgctgaat tacgccatta accgtccggc gctggtgaaa       900
     gttgcctttg cgggctatgc aacgccagct actggtgtgg taccgccaag tatcgcctac       960
     gcgcaaagtt ataaaccgtg gccttacgat ccagtgaaag cgcgcgaatt actgaaagag      1020
     gcgggatatc ccaacggttt cagtaccacg ctgtggtcgt cacataacca cagcaccgcg      1080
     cagaaagtgc tgcaatttac ccagcagcag ttagcgcagg tcgggattaa agcccaggtg      1140
     actgcgatgg atgccggaca gcgggcggca gaagttgaag gtaaagggca aaaagagagc      1200
     ggcgtgcgga tgttctacac tggctggtcg gcttcaaccg gcgaagcgga ctgggcacta      1260
     tcgccgctgt ttgcctcgca gaactggcca ccgacgctgt ttaataccgc gttttacagc      1320
     aataaacagg tggatgactt cctggctcag gcactgaaaa ctaatgatcc ggcggaaaag      1380
     acccgcttat ataaggcggc gcaggatatc atctggcaag aatcgccgtg gatcccgctg      1440
     gtggtagaaa aactggtgtc ggcacacagt aaaaacctga ccggtttttg gatcatgcca      1500
     gacaccggct tcagctttga agacgcggat ttgcaataa                             1539
//

If you have problems or comments...

PBIL Back to PBIL home page