(data stored in SCRATCH3701 zone)

EMBL: CP001396.HOKE

CP001396.HOKE        Location/Qualifiers
FT   CDS_pept        509819..509971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hokE"
FT                   /locus_tag="BWG_0453"
FT                   /product="toxic polypeptide, small"
FT                   /note="MG1655 equivalent: b4415"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACR65667"
FT                   /protein_id="ACR65667.1"
FT                   /translation="MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLA
FT                   YEPKK"
     atgctgacga aatatgccct tgcggcagtc atagtgctgt gtttaacggt gctgggattt        60
     acgcttctgg tcggagactc gctgtgtgag tttacggtga aggaacgtaa tattgagttt       120
     aaggctgttc tcgcttacga accgaagaag tag                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page