(data stored in SCRATCH3701 zone)

EMBL: CP001396.ILVH

CP001396.ILVH        Location/Qualifiers
FT   CDS_pept        87356..87847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvH"
FT                   /locus_tag="BWG_0074"
FT                   /product="acetolactate synthase III, thiamin-dependent,
FT                   small subunit"
FT                   /note="MG1655 equivalent: b0078"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACR61903"
FT                   /protein_id="ACR61903.1"
FT                   /translation="MRRILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTDDPTLSR
FT                   MTIQTVGDEKVLEQIEKQLHKLVDVLRVSELGQGAHVEREIMLVKIQASGYGRDEVKRN
FT                   TEIFRGQIIDVTPSLYTVQLAGTSGKLDAFLASIRDVAKIVEVARSGVVGLSRGDKIMR
FT                   "
     atgcgccgga tattatcagt cttactcgaa aatgaatcag gcgcgttatc ccgtgtgatt        60
     ggcctttttt cccagcgtgg ctacaacatt gaaagcctga ccgttgcgcc aaccgacgat       120
     ccgacattat cgcgtatgac catccagacc gtgggcgatg aaaaagtact tgagcagatc       180
     gaaaagcaat tacacaaact ggtcgatgtc ttgcgcgtga gtgagttggg gcagggcgcg       240
     catgttgagc gggaaatcat gctggtgaaa attcaggcca gcggttacgg gcgtgacgaa       300
     gtgaaacgta atacggaaat attccgtggg caaattatcg atgtcacacc ctcgctttat       360
     accgttcaat tagcaggcac cagcggtaag cttgatgcat ttttagcatc gattcgcgat       420
     gtggcgaaaa ttgtggaggt tgctcgctct ggtgtggtcg gactttcgcg cggcgataaa       480
     ataatgcgtt ga                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page