(data stored in SCRATCH3701 zone)

EMBL: CP001396.IRAP

CP001396.IRAP        Location/Qualifiers
FT   CDS_pept        303369..303629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iraP"
FT                   /locus_tag="BWG_0266"
FT                   /product="predicted protein"
FT                   /note="MG1655 equivalent: b0382"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACR64948"
FT                   /db_xref="GOA:C4ZTE1"
FT                   /db_xref="InterPro:IPR019732"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4ZTE1"
FT                   /protein_id="ACR64948.1"
FT                   /translation="MKNLIAELLFKLAQKEEESKELCAQVEALEIIVTAMLRNMAQNDQ
FT                   QRLIDQVEGALYEVKPDASIPDDDTELLRDYVKKLLKHPRQ"
     atgaaaaatc tcattgctga gttgttattt aagcttgccc aaaaagaaga agagtcgaaa        60
     gaactgtgtg cgcaggtaga agctttggag attatcgtca ctgcaatgct tcgcaatatg       120
     gcgcaaaatg accaacagcg gttgattgat caggtagagg gggcgctgta cgaggtaaag       180
     cccgatgcca gcattcctga cgacgatacg gagctgctgc gcgattacgt aaagaagtta       240
     ttgaagcatc ctcgtcagta a                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page