(data stored in SCRATCH3701 zone)

EMBL: CP001396.METN

CP001396.METN        Location/Qualifiers
FT   CDS_pept        complement(221613..222644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metN"
FT                   /locus_tag="BWG_0192"
FT                   /product="DL-methionine transporter subunit"
FT                   /note="MG1655 equivalent: b0199"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACR62784"
FT                   /protein_id="ACR62784.1"
FT                   /translation="MIKLSNITKVFHQGTRTIQALNNVSLHVPAGQIYGVIGASGAGKS
FT                   TLIRCVNLLERPTEGSVLVDGQELTTLSESELTKARRQIGMIFQHFNLLSSRTVFGNVA
FT                   LPLELDNTPKDEVKRRVTELLSLVGLGDKHDSYPSNLSGGQKQRVAIARALASNPKVLL
FT                   CDEATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICDCVAVISNGELIEQ
FT                   DTVSEVFSHPKTPLAQKFIQSTLHLDIPEDYQERLQAEPFTDCVPMLRLEFTGQSVDAP
FT                   LLSETARRFNVNNNIISAQMDYAGGVKFGIMLTEMHGTQQDTQAAIAWLQEHHVKVEVL
FT                   GYV"
     atgataaaac tttcgaatat caccaaagtg ttccaccagg gcacccgcac catccaggcg        60
     ttgaacaacg tcagcctgca tgtgccagct ggacaaattt atggcgttat cggtgcctca       120
     ggcgcgggta agagtacgct tatacgttgt gtaaacctgc tggagcgccc aaccgagggt       180
     agcgtgctgg tcgatggcca ggaactgacc acgctgtcag aatccgagtt gaccaaagct       240
     cgccgccaga ttggtatgat tttccagcat tttaacctgc tctcttcgcg tactgttttt       300
     ggcaacgtgg ctctgccgct ggagctggac aacacaccga aagacgaggt caaacgtcgc       360
     gtgacggaat tgctgtcatt ggttggtctt ggcgataagc atgatagcta cccgtcgaat       420
     ctttccggtg ggcagaaaca acgtgtggca attgcccgtg cgttagccag caatcccaaa       480
     gtattgctgt gtgatgaagc caccagcgcg ctggacccgg caacgacacg ttctattctc       540
     gaactgctga aagacatcaa ccgccgtctg gggttgacga ttctgttgat cacccacgaa       600
     atggacgttg tgaagcgcat ttgtgattgc gtggcggtca tcagcaatgg agaactgatc       660
     gagcaggaca cggtaagtga agtgttctcg catccgaaaa cgccgctggc gcagaagttt       720
     attcagtcga ccctgcatct ggatatcccg gaagattacc aggaacgtct gcaagcggag       780
     ccatttactg actgcgtgcc gatgctgcgt ctggagttta ccggtcaatc ggtcgatgcc       840
     ccactgcttt ctgaaaccgc gcgtcgtttc aacgtcaaca acaacattat tagcgcgcag       900
     atggattacg ccggtggcgt taagttcggc atcatgctga ctgaaatgca cggcacacaa       960
     caagatacgc aagccgccat tgcctggctg caggaacacc atgtaaaagt agaggtactg      1020
     ggttatgtct ga                                                          1032
//

If you have problems or comments...

PBIL Back to PBIL home page