(data stored in SCRATCH3701 zone)

EMBL: CP001396.MOAD

CP001396.MOAD        Location/Qualifiers
FT   CDS_pept        721239..721484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaD"
FT                   /locus_tag="BWG_0637"
FT                   /product="molybdopterin synthase, small subunit"
FT                   /note="MG1655 equivalent: b0784"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ACR63802"
FT                   /protein_id="ACR63802.1"
FT                   /translation="MIKVLFFAQVRELVGTDATEVAADFPTVEALRQHMAAQSDRWALA
FT                   LEDGKLLAAVNQTLVSFDHPLTDGDEVAFFPPVTGG"
     atgattaaag ttcttttttt cgcccaggtg cgcgagttgg tgggaacaga tgcaaccgaa        60
     gtggctgcgg atttcccaac tgttgaagcg ttacgccagc acatggctgc gcagagcgat       120
     cgctgggcgc tggcgctgga agatggcaaa ttactggctg ccgtcaacca gacgctggtg       180
     agttttgacc atccgctgac tgacggcgac gaagtagctt tcttcccgcc ggtaaccgga       240
     ggttaa                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page