(data stored in SCRATCH3701 zone)

EMBL: CP001396.MODA

CP001396.MODA        Location/Qualifiers
FT   CDS_pept        697280..698053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modA"
FT                   /locus_tag="BWG_0615"
FT                   /product="molybdate transporter subunit"
FT                   /note="MG1655 equivalent: b0763"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACR63792"
FT                   /protein_id="ACR63792.1"
FT                   /translation="MARKWLNLFAGAALSFAVAGNALADEGKITVFAAASLTNAMQDIA
FT                   TQFKKEKGVDVVSSFASSSTLARQIEAGAPADLFISADQKWMDYAVDKKAIDTATRQTL
FT                   LGNSLVVVAPKASVQKDFTIDSKTNWTSLLNGGRLAVGDPEHVPAGIYAKEALQKLGAW
FT                   DTLSPKLAPAEDVRGALALVERNEAPLGIVYGSDAVASKGVKVVATFPEDSHKKVEYPV
FT                   AVVEGHNNATVKAFYDYLKGPQAAEIFKRYGFTIK"
     atggctcgta aatggttgaa cttgtttgcc ggggcggcac tctctttcgc tgttgctggc        60
     aatgcactgg cagatgaagg gaaaatcacg gtgttcgccg ccgcatcact gactaacgca       120
     atgcaggaca ttgctacgca gtttaaaaaa gagaaaggcg tggatgtggt ttcttctttc       180
     gcttcgtcat ctactctcgc ccgtcagatt gaagcgggtg cgcctgcgga tctgtttatt       240
     tctgccgatc agaaatggat ggattatgcg gttgataaaa aagcgatcga tacagctacg       300
     cgtcagacac tgctcggcaa tagcctggtc gttgtagcac cgaaagccag cgtgcagaaa       360
     gatttcacca tcgacagcaa aaccaactgg acttcactgc tgaatggcgg tcgcctggcg       420
     gttggcgatc cggaacatgt tcccgctggc atttatgcaa aagaagcact gcaaaaactg       480
     ggcgcatggg atacgctctc tccgaaactg gccccagcgg aagatgttcg tggggcgctg       540
     gcgctggtcg aacgtaacga agcgcctctg ggcattgtct acggttctga cgcagttgcc       600
     agcaaagggg taaaagtggt tgccaccttc ccggaagatt cacataaaaa agtggaatat       660
     ccggttgctg ttgtggaagg gcataacaat gcgacagtga aagcatttta tgattatctg       720
     aagggaccgc aggcagcgga aatctttaaa cgttacggat ttacaatcaa gtaa             774
//

If you have problems or comments...

PBIL Back to PBIL home page