(data stored in SCRATCH3701 zone)

EMBL: CP001396.MODB

CP001396.MODB        Location/Qualifiers
FT   CDS_pept        698053..698742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modB"
FT                   /locus_tag="BWG_0616"
FT                   /product="molybdate transporter subunit"
FT                   /note="MG1655 equivalent: b0764"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACR63793"
FT                   /protein_id="ACR63793.1"
FT                   /translation="MILTDPEWQAVLLSLKVSSLAVLFSLPFGIFFAWLLVRCTFPGKA
FT                   LLDSVLHLPLVLPPVVVGYLLLVSMGRRGFIGERLYDWFGITFAFSWRGAVLAAAVMSF
FT                   PLMVRAIRLALEGVDVKLEQAARTLGAGRWRVFFTITLPLTLPGIIVGTVLAFARSLGE
FT                   FGATITFVSNIPGETRTIPSAMYTLIQTPGGESGAARLCIISIALAMISLLISEWLARI
FT                   SRERAGR"
     atgatactga ccgatccaga atggcaggca gttttattaa gcctgaaagt ttcttccctg        60
     gctgtgctgt ttagcctgcc gtttgggatc ttttttgcct ggttactggt gcgttgcacg       120
     tttccgggca aagctctgct cgacagcgta ctgcatctac cgctggtgtt accgcccgtg       180
     gtcgtcggtt acttattatt agtttcgatg ggacggcgcg gatttatcgg tgaacgtctg       240
     tatgactggt ttggtattac cttcgccttt agctggcgcg gcgcggttct cgctgccgcc       300
     gtcatgtcgt ttccgctgat ggtgcgggca attcgtctgg cgctggaagg ggttgatgtc       360
     aaactggaac aggccgcaag aacactgggg gccgggcgct ggcgcgtttt ctttactatc       420
     acgttaccgc tgaccttacc gggaattatt gttggtacgg tactggcttt tgctcgttct       480
     ctcggtgagt ttggtgcaac catcaccttt gtgtcgaaca ttcctggtga aacgcgaacc       540
     attccttctg ccatgtatac cctgatccag acccccggcg gggaaagtgg agcggcgaga       600
     ctgtgcatta tttctattgc gctggcgatg atctccctgt tgatttcaga atggctggcc       660
     agaatcagcc gtgaacgggc ggggcgctaa                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page