(data stored in SCRATCH3701 zone)

EMBL: CP001396.MOEA

CP001396.MOEA        Location/Qualifiers
FT   CDS_pept        complement(767320..768555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moeA"
FT                   /locus_tag="BWG_0680"
FT                   /product="molybdopterin biosynthesis protein"
FT                   /note="MG1655 equivalent: b0827"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ACR63796"
FT                   /protein_id="ACR63796.1"
FT                   /translation="MEFTTGLMSLDTALNEMLSRVTPLTAQETLPLVQCFGRILASDVV
FT                   SPLDVPGFDNSAMDGYAVRLADIASGQPLPVAGKSFAGQPYHGEWPAGTCIRIMTGAPV
FT                   PEGCEAVVMQEQTEQMDNGVRFTAEVRSGQNIRRRGEDISAGAVVFPAGTRLTTAELPV
FT                   IASLGIAEVPVIRKVRVALFSTGDELQLPGQPLGDGQIYDTNRLAVHLMLEQLGCEVIN
FT                   LGIIRDDPHALRAAFIEADSQADVVISSGGVSVGEADYTKTILEELGEIAFWKLAIKPG
FT                   KPFAFGKLSNSWFCGLPGNPVSATLTFYQLVQPLLAKLSGNTASGLPARQRVRTASRLK
FT                   KTPGRLDFQRGVLQRNADGELEVTTTGHQGSHIFSSFSLGNCFIVLERDRGNVEVGEWV
FT                   EVEPFNALFGGL"
     atggaattta ccaccggatt gatgtcgctc gacaccgcgc ttaatgagat gctttctcgc        60
     gtcaccccac tgaccgccca ggaaacgctg ccactggtac agtgttttgg tcgtattctg       120
     gcgagcgatg tcgtttcgcc gcttgatgtt ccggggtttg ataactccgc aatggacggc       180
     tacgcggtgc gtttagccga tattgcctcc gggcaaccgc tgcccgttgc cggtaaatcc       240
     tttgccggtc agccatacca tggtgaatgg cctgcgggta cctgcattcg tattatgacc       300
     ggtgcgccgg tgccggaagg ctgcgaagcg gtggtgatgc aggagcagac tgaacaaatg       360
     gacaatggcg tgcgttttac tgctgaagtg cgtagcgggc aaaatattcg ccgtcgcggt       420
     gaagatatct ctgcaggtgc ggttgttttc ccggcgggaa ctcgcctgac taccgcagag       480
     ctgccagtaa ttgcttcact ggggattgcc gaagttccgg tgattcgtaa agtgcgtgta       540
     gcgctttttt ctaccggtga tgaactccag ttgcccggtc agccgctggg cgacggccaa       600
     atctacgata ccaaccgtct cgccgtacac ctgatgttag aacagttggg atgcgaggta       660
     attaacttag ggattatccg cgacgatccc catgccctgc gcgccgcatt tattgaagcc       720
     gacagccagg cggatgtggt gatcagttcc ggcggtgttt cagtgggtga ggcggattac       780
     accaaaacga ttcttgaaga gctgggggag atcgccttct ggaagctggc gattaaacca       840
     ggtaaaccgt tcgcgttcgg taaactcagc aatagctggt tctgcggcct gccgggcaac       900
     ccggtttcag cgacgctgac cttctatcaa ctggtacagc ctttgctggc aaaactaagc       960
     ggtaacaccg ccagcggcct gcccgcgcgc cagcgcgtac gcacagcgtc ccgcctgaaa      1020
     aaaacgccag gacgtcttga tttccagcgc ggcgtgctgc aacgcaacgc cgatggcgaa      1080
     ctggaagtga cgaccaccgg acatcagggt tcacatatat ttagctcctt tagcctcggc      1140
     aactgcttta tcgtgctgga acgcgatcgc ggcaatgtgg aagtgggcga atgggtggaa      1200
     gtagaaccgt ttaacgcgtt gttcggaggc ctgtaa                                1236
//

If you have problems or comments...

PBIL Back to PBIL home page