(data stored in SCRATCH3701 zone)

EMBL: CP001396.POTF

CP001396.POTF        Location/Qualifiers
FT   CDS_pept        795975..797087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potF"
FT                   /locus_tag="BWG_0707"
FT                   /product="putrescine transporter subunit:
FT                   periplasmic-binding component of ABC superfamily"
FT                   /note="MG1655 equivalent: b0854"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0707"
FT                   /db_xref="EnsemblGenomes-Tr:ACR65340"
FT                   /protein_id="ACR65340.1"
FT                   /translation="MTALNKKWLSGLVAGALMAVSVGTLAAEQKTLHIYNWSDYIAPDT
FT                   VANFEKETGIKVVYDVFDSNEVLEGKLMAGSTGFDLVVPSASFLERQLTAGVFQPLDKS
FT                   KLPEWKNLDPELLKLVAKHDPDNKFAMPYMWATTGIGYNVDKVKAVLGENAPVDSWDLI
FT                   LKPENLEKLKSCGVSFLDAPEEVFATVLNYLGKDPNSTKADDYTGPATDLLLKLRPNIR
FT                   YFHSSQYINDLANGDICVAIGWAGDVWQASNRAKEAKNGVNVSFSIPKEGAMAFFDVFA
FT                   MPADAKNKDEAYQFLNYLLRPDVVAHISDHVFYANANKAATPLVSAEVRENPGIYPPAD
FT                   VRAKLFTLKVQDPKIDRVRTRAWTKVKSGK"
     atgaccgcct taaataaaaa atggctatcg ggtctggttg cgggtgctct gatggccgtc        60
     tctgtcggca cgctcgcggc tgaacaaaaa acactccaca tttataactg gtctgattat       120
     atcgccccgg acacggtggc caattttgaa aaagaaaccg gtattaaagt cgtctacgat       180
     gttttcgact ctaacgaagt actggaaggc aaattaatgg ccgggagtac cggctttgat       240
     ctggtggttc catctgccag ctttctggag cgccagttga ctgcgggagt tttccagccg       300
     ctggacaaaa gcaaattgcc ggagtggaag aatctcgacc cggaactgct gaagctggtc       360
     gccaaacacg atcccgacaa taaatttgct atgccctata tgtgggcgac gaccgggatt       420
     ggctataacg ttgataaagt taaagcggtg ctgggcgaaa acgcgcccgt cgatagctgg       480
     gacttgatcc tcaaacctga aaatctggaa aaactgaaaa gctgcggtgt ctctttcctg       540
     gatgcgccag aagaagtttt tgctaccgtg ttgaattatc tcggcaaaga tcccaacagc       600
     actaaagcgg atgattacac cggaccggca acagatctgc tgttaaagct gcgcccgaac       660
     attcgttatt tccattcatc tcaatacatt aacgacctgg caaacggcga tatttgcgtc       720
     gctatcggct gggcaggtga tgtctggcag gcgtcaaacc gcgcgaagga agcgaagaat       780
     ggcgtgaatg tctcgttctc gattccaaaa gaaggggcga tggcgttctt tgatgtattc       840
     gccatgcctg cggatgccaa aaacaaagac gaagcctatc agttcctgaa ttacctgctg       900
     cgcccggatg tagtagcgca tatttccgac catgtgttct atgccaacgc caataaagca       960
     gccacgccgc tggtgagtgc ggaagtccgt gagaacccag gtatttatcc gcctgcggat      1020
     gttcgtgcga agctgttcac tctgaaagtg caggatccga aaatcgaccg tgtgcgcacc      1080
     cgcgcgtgga ccaaagtgaa gagcggaaaa taa                                   1113
//

If you have problems or comments...

PBIL Back to PBIL home page