(data stored in SCRATCH3701 zone)

EMBL: CP001396.POTH

CP001396.POTH        Location/Qualifiers
FT   CDS_pept        798325..799278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potH"
FT                   /locus_tag="BWG_0709"
FT                   /product="putrescine transporter subunit: membrane
FT                   component of ABC superfamily"
FT                   /note="MG1655 equivalent: b0856"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0709"
FT                   /db_xref="EnsemblGenomes-Tr:ACR65338"
FT                   /protein_id="ACR65338.1"
FT                   /translation="MSTLEPAAQSKPPGGFKLWLSQLQMKHGRKLVIALPYIWLILLFL
FT                   LPFLIVFKISLAEMARAIPPYTELMEWADGQLSITLNLGNFLQLTDDPLYFDAYLQSLQ
FT                   VAAISTFCCLLIGYPLAWAVAHSKPSTRNILLLLVILPSWTSFLIRVYAWMGILKNNGV
FT                   LNNFLLWLGVIDQPLTILHTNLAVYIGIVYAYVPFMVLPIYTALIRIDYSLVEAALDLG
FT                   ARPLKTFFTVIVPLTKGGIIAGSMLVFIPAVGEFVIPELLGGPDSIMIGRVLWQEFFNN
FT                   RDWPVASAVAIIMLLLLIVPIMWFHKHQQKSVGEHG"
     atgagtacac ttgaacctgc tgcccagtcg aaaccgccgg gcggatttaa gctgtggttg        60
     tcgcagctgc aaatgaagca tgggcgcaaa ctggtcattg cgttgccata tatctggttg       120
     atcttgctgt ttctgctgcc atttctgatt gtctttaaaa taagcctggc ggagatggcg       180
     cgcgctattc caccttatac cgaactgatg gagtgggctg acgggcaact gtccatcact       240
     cttaatctcg gtaattttct gcaactgacc gacgatccgc tctatttcga tgcttatctc       300
     cagtcgctac aggtggctgc gatttcgaca ttttgctgtt tactgatcgg ctatccgctg       360
     gcgtgggcgg tggcgcacag taagccttcg acccgtaata ttttattact actggtgatc       420
     ctgccgtcgt ggacctcgtt tctgatccgc gtttatgcct ggatgggaat attaaaaaac       480
     aacggtgtgc tgaataattt tctgctgtgg ctgggggtta tcgatcaacc gctgaccatt       540
     ctgcatacca atctggccgt ttatatcggc attgtttacg cttacgtgcc gtttatggta       600
     ctgccgattt ataccgcgtt gattcgtatt gattattcgc tggtggaagc agcgctggat       660
     ctcggtgcac gaccgctgaa aacgttcttt actgtgatcg tgccgctgac taaaggtggg       720
     attattgccg gatcgatgct ggtgtttatc ccggctgtgg gcgagtttgt gatcccggaa       780
     ctgctcggtg gcccggacag catcatgatc gggcgcgtgc tatggcaaga gtttttcaat       840
     aaccgcgact ggccggtggc ctcggcggta gcgatcatca tgttgctgct gctaattgtg       900
     ccgataatgt ggttccacaa acaccagcaa aaaagcgtgg gagaacacgg atga             954
//

If you have problems or comments...

PBIL Back to PBIL home page