(data stored in SCRATCH3701 zone)

EMBL: CP001396.POTI

CP001396.POTI        Location/Qualifiers
FT   CDS_pept        799275..800120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potI"
FT                   /locus_tag="BWG_0710"
FT                   /product="putrescine transporter subunit: membrane
FT                   component of ABC superfamily"
FT                   /note="MG1655 equivalent: b0857"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0710"
FT                   /db_xref="EnsemblGenomes-Tr:ACR65339"
FT                   /protein_id="ACR65339.1"
FT                   /translation="MNNLPVVRSPWRIVILLLGFTFLYAPMLMLVIYSFNSSKLVTVWA
FT                   GWSTRWYGELLRDDAMMSAVGLSLTIAACAATAAAILGTIAAVVLVRFGRFRGSNGFAF
FT                   MITAPLVMPDVITGLSLLLLFVALAHAIGWPADRGMLTIWLAHVTFCTAYVAVVISSRL
FT                   RELDRSIEEAAMDLGATPLKVFFVITLPMIMPAIISGWLLAFTLSLDDLVIASFVSGPG
FT                   ATTLPMLVFSSVRMGVNPEINALATLILGAVGIVGFIAWYLMARAEKQRIRDIQRARRG
FT                   "
     atgaataatt taccggtagt tcgttcgccc tggcggattg tgattttgct gctgggcttt        60
     acctttctct acgcgccaat gctgatgctg gttatctatt cgtttaacag ctcgaagctg       120
     gtgacggtgt gggccggctg gtcaacgcgc tggtatggtg agttattgcg cgatgacgcg       180
     atgatgagtg cggttggttt aagtctgaca attgcggcct gtgcggcgac ggcggcggcg       240
     atcctcggaa ctattgcggc ggtggtgctg gtgcgctttg gcaggtttcg cggatcaaat       300
     ggctttgcct ttatgatcac cgcgccgctg gtaatgccag atgtcatcac gggcttgtcg       360
     ctgttgttat tattcgtcgc gcttgctcat gccattggct ggcctgcgga ccgcggtatg       420
     ctcaccatct ggctggcgca tgtcactttt tgtacggctt atgtggcggt cgttatttct       480
     tcaagattgc gggaactgga tcgctcgata gaagaagcag cgatggatct cggtgcgacg       540
     ccgctgaaag tgtttttcgt cattacgcta ccgatgatca tgcccgcgat catttctggc       600
     tggttactgg cttttacttt gtcgcttgat gatctggtga tcgccagctt tgtttccggg       660
     ccgggagcca ccacgttacc gatgctggtc ttttccagcg tgcggatggg ggtgaatccg       720
     gaaatcaacg ccctggcaac attgatcctc ggcgcggtcg gaattgtcgg atttatcgcc       780
     tggtatctga tggctcgcgc agaaaaacag cggatacgcg acatccagcg tgcaagacgt       840
     ggctga                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page