(data stored in SCRATCH3701 zone)

EMBL: CP001396.PSIF

CP001396.PSIF        Location/Qualifiers
FT   CDS_pept        305264..305584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psiF"
FT                   /locus_tag="BWG_0268"
FT                   /product="conserved protein"
FT                   /note="MG1655 equivalent: b0384"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACR62431"
FT                   /protein_id="ACR62431.1"
FT                   /translation="MKITLLVTLLFGLVFLTTVGAAERTLTPQQQRMTSCNQQATAQAL
FT                   KGDARKTYMSDCLKNSKSAPGEKSLTPQQQKMRECNNQATQQSLKGDDRNKFMSACLKK
FT                   AA"
     atgaaaataa cattactggt taccttgctt ttcggtctgg tttttttaac caccgtcggc        60
     gctgccgaga gaactttaac cccacaacaa cagcgtatga cctcctgtaa tcagcaggcg       120
     acggcgcagg cgttgaaagg ggatgctcgt aagacctaca tgagtgattg cctgaagaac       180
     agcaagtctg cgcctggcga aaaaagtttg acgccacagc agcaaaagat gcgcgaatgc       240
     aataatcaag caacacaaca atctctgaaa ggtgatgatc gtaataagtt tatgagtgcc       300
     tgcctcaaga aagccgcctg a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page