(data stored in SCRATCH3701 zone)

EMBL: CP001396.SDHC

CP001396.SDHC        Location/Qualifiers
FT   CDS_pept        657160..657549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhC"
FT                   /locus_tag="BWG_0580"
FT                   /product="succinate dehydrogenase, membrane subunit, binds
FT                   cytochrome b556"
FT                   /note="MG1655 equivalent: b0721"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACR65586"
FT                   /protein_id="ACR65586.1"
FT                   /translation="MIRNVKKQRPVNLDLQTIRFPITAIASILHRVSGVITFVAVGILL
FT                   WLLGTSLSSPEGFEQASAIMGSFFVKFIMWGILTALAYHVVVGIRHMMMDFGYLEETFE
FT                   AGKRSAKISFVITVVLSLLAGVLVW"
     atgataagaa atgtgaaaaa acaaagacct gttaatctgg acctacagac catccggttc        60
     cccatcacgg cgatagcgtc cattctccat cgcgtttccg gtgtgatcac ctttgttgca       120
     gtgggcatcc tgctgtggct tctgggtacc agcctctctt cccctgaagg tttcgagcaa       180
     gcttccgcga ttatgggcag cttcttcgtc aaatttatca tgtggggcat ccttaccgct       240
     ctggcgtatc acgtcgtcgt aggtattcgc cacatgatga tggattttgg ctatctggaa       300
     gaaacattcg aagcgggtaa acgctccgcc aaaatctcct ttgttattac tgtcgtgctt       360
     tcacttctcg caggagtcct cgtatggtaa                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page