(data stored in SCRATCH3701 zone)

EMBL: CP001396.TOLR

CP001396.TOLR        Location/Qualifiers
FT   CDS_pept        677832..678260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolR"
FT                   /locus_tag="BWG_0597"
FT                   /product="membrane spanning protein in TolA-TolQ-TolR
FT                   complex"
FT                   /note="MG1655 equivalent: b0738"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACR63743"
FT                   /protein_id="ACR63743.1"
FT                   /translation="MARARGRGRRDLKSEINIVPLLDVLLVLLLIFMATAPIITQSVEV
FT                   DLPDATESQAVSSNDNPPVIVEVSGIGQYTVVVEKDRLERLPPEQVVAEVSSRFKANPK
FT                   TVFLIGGAKDVPYDEIIKALNLLHSAGVKSVGLMTQPI"
     atggccagag cgcgtggacg aggtcgtcgc gatctcaagt ccgaaatcaa cattgtaccg        60
     ttgctggacg tactgctggt gctgttgctg atctttatgg cgacagcgcc catcatcacc       120
     cagagcgtgg aggtcgatct gccagacgct actgaatcac aggcggtgag cagtaacgat       180
     aatccgccag tgattgttga agtgtctggt attggtcagt acaccgtggt ggttgagaaa       240
     gatcgcctgg agcgtttacc accagagcag gtggtggcgg aagtgtccag ccgtttcaag       300
     gccaacccga aaacggtctt tctgatcggt ggcgcaaaag atgtgcctta cgatgaaata       360
     attaaagcac tgaacttgtt acatagtgcg ggtgtgaaat cggttggttt aatgacgcag       420
     cctatctaa                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page