(data stored in SCRATCH3701 zone)

EMBL: CP001396.YAJD

CP001396.YAJD        Location/Qualifiers
FT   CDS_pept        332588..332935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajD"
FT                   /locus_tag="BWG_0292"
FT                   /product="conserved protein"
FT                   /note="MG1655 equivalent: b0410"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACR62435"
FT                   /protein_id="ACR62435.1"
FT                   /translation="MAIIPKNYARLESGYREKALKIYPWVCGRCSREFVYSNLRELTVH
FT                   HIDHDHTNNPEDGSNWELLCLYCHDHEHSKYTEADQYGTTVIAGEDAQKDVGEAKYNPF
FT                   ADLKAMMNKKK"
     atggctatca tcccaaaaaa ctatgcgcgg ttagaaagcg gctatcgcga aaaagcatta        60
     aaaatctatc cgtgggtctg cggtcgctgt tcccgcgagt ttgtttattc caacctgcgt       120
     gaacttaccg ttcaccacat tgatcacgac cataccaata acccggaaga tggcagtaac       180
     tgggaattgt tgtgtctcta ttgccacgat catgagcatt cgaaatatac cgaagcggat       240
     cagtatggta cgaccgttat cgcaggggaa gatgcgcaga aagatgtcgg tgaagcgaag       300
     tacaacccat tcgctgacct gaaagcgatg atgaacaaga agaagtga                    348
//

If you have problems or comments...

PBIL Back to PBIL home page