(data stored in SCRATCH3701 zone)

EMBL: CP001396.YAJQ

CP001396.YAJQ        Location/Qualifiers
FT   CDS_pept        346666..347157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajQ"
FT                   /locus_tag="BWG_0308"
FT                   /product="predicted nucleotide binding protein"
FT                   /note="MG1655 equivalent: b0426"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACR64695"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4ZTI3"
FT                   /protein_id="ACR64695.1"
FT                   /translation="MPSFDIVSEVDLQEARNAVDNASREVESRFDFRNVEASFELNDAS
FT                   KTIKVLSESDFQVNQLLDILRAKLLKRGIEGSSLDVPENIVHSGKTWFVEAKLKQGIES
FT                   ATQKKIVKMIKDSKLKVQAQIQGDEIRVTGKSRDDLQAVMAMVRGGDLGQPFQFKNFRD
FT                   "
     atgccatctt tcgatattgt ctctgaagtt gatcttcagg aagcacgtaa cgcggtcgat        60
     aacgcgagcc gcgaagtgga gtcccgtttt gacttccgta acgttgaagc ctcatttgag       120
     ctgaacgacg ccagcaaaac catcaaagtg ttgagcgagt ccgatttcca ggtcaatcag       180
     ttgctggata ttctgcgtgc caagctgctg aagcgcggca ttgaaggcag ttcgctggat       240
     gtaccggaga atatcgttca tagcggtaaa acctggtttg tggaagcgaa actgaaacag       300
     ggcattgaga gcgcgaccca gaagaaaatc gtcaagatga tcaaagacag caaactgaaa       360
     gtgcaggcgc aaattcaggg cgatgaaatc cgcgtaacgg gcaaatctcg tgatgatttg       420
     caggctgtca tggcgatggt acgtggtggc gatctcggtc agccgttcca gttcaaaaac       480
     ttccgcgatt aa                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page