(data stored in SCRATCH3701 zone)

EMBL: CP001396.YBAJ

CP001396.YBAJ        Location/Qualifiers
FT   CDS_pept        complement(382317..382691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaJ"
FT                   /locus_tag="BWG_0342"
FT                   /product="predicted protein"
FT                   /note="MG1655 equivalent: b0461"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACR64845"
FT                   /protein_id="ACR64845.1"
FT                   /translation="MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAIN
FT                   LQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYLDDTFMLFSSYGINMQDLQKWRKSG
FT                   NRLFRCFVNATKENPASLSC"
     atggatgaat actcacccaa aagacatgat atcgcacagc ttaagtttct ctgtgaaacc        60
     ctgtatcatg actgccttgc aaaccttgaa gaaagcaatc atggctgggt aaacgaccca       120
     acctcggcga tcaacctcca gttgaatgaa ctgattgagc atattgcgac cttcgcactt       180
     aattacaaaa ttaagtataa tgaagacaat aagctcattg agcagatcga cgaatatctg       240
     gatgacacct ttatgttgtt cagtagttat ggtattaata tgcaggatct tcagaaatgg       300
     cggaagtcag gtaatcgact attccgttgt tttgtcaatg cgacgaaaga gaatcctgcg       360
     agtttatctt gttag                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page