(data stored in SCRATCH3701 zone)

EMBL: CP001396.YBDD

CP001396.YBDD        Location/Qualifiers
FT   CDS_pept        534165..534362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdD"
FT                   /locus_tag="BWG_0472"
FT                   /product="conserved protein"
FT                   /note="MG1655 equivalent: b4512"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACR62580"
FT                   /protein_id="ACR62580.1"
FT                   /translation="MFDSLAKAGKYLGQAAKLMIGMPDYDNYVEHMRVNHPDQTPMTYE
FT                   EFFRERQDARYGGKGGARCC"
     atgtttgatt cactggcaaa agccggaaaa tatttaggtc aggcggcgaa gctgatgatt        60
     ggtatgcctg attacgacaa ctatgtcgaa catatgcggg ttaaccatcc cgatcaaacg       120
     ccgatgacct acgaagagtt tttccgtgag cggcaggacg cgcgctacgg tggaaaaggc       180
     ggcgcgcgct gctgctaa                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page