(data stored in SCRATCH3701 zone)

EMBL: CP001396.YBDZ

CP001396.YBDZ        Location/Qualifiers
FT   CDS_pept        515925..516143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdZ"
FT                   /locus_tag="BWG_0458"
FT                   /product="conserved protein"
FT                   /note="MG1655 equivalent: b4511"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACR62579"
FT                   /protein_id="ACR62579.1"
FT                   /translation="MAFSNPFDDPQGAFYILRNAQGQFSLWPQQCVLPAGWDIVCQPQS
FT                   QASCQQWLEAHWRTLTPTNFTQLQEAQ"
     atggcattca gtaatccctt cgatgatccg cagggagcgt tttacatatt gcgcaatgcg        60
     caggggcaat tcagtctgtg gccgcaacaa tgcgtcttac cggcaggctg ggacattgtg       120
     tgtcagccgc agtcacaggc gtcctgccag cagtggctgg aagcccactg gcgtactctg       180
     acaccgacga attttaccca gttgcaggag gcacaatga                              219
//

If you have problems or comments...

PBIL Back to PBIL home page