(data stored in SCRATCH3701 zone)

EMBL: CP001396.YBFA

CP001396.YBFA        Location/Qualifiers
FT   CDS_pept        631117..631323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfA"
FT                   /locus_tag="BWG_0560"
FT                   /product="predicted protein"
FT                   /note="MG1655 equivalent: b0699"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACR64953"
FT                   /protein_id="ACR64953.1"
FT                   /translation="MELYREYPAWLIFLRRTYAVAAGVLALPFMLFWKDRARFYSYLHR
FT                   VWSKTSDKPVWMDQAEKATGDFY"
     atggaactct acagagaata tcctgcatgg cttatctttt tacgccgtac ttatgcggtt        60
     gcagcgggcg ttctggcgct gcctttcatg cttttctgga aagaccgcgc ccgcttttac       120
     agctacctgc atcgcgtctg gtcgaaaacc agcgataaac cggtgtggat ggatcaggcc       180
     gaaaaggcaa ctggtgattt ttattga                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page