(data stored in SCRATCH3701 zone)

EMBL: CP001396.YBGA

CP001396.YBGA        Location/Qualifiers
FT   CDS_pept        640984..641493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgA"
FT                   /locus_tag="BWG_0566"
FT                   /product="conserved protein"
FT                   /note="MG1655 equivalent: b0707"
FT                   /db_xref="EnsemblGenomes-Gn:BWG_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACR62445"
FT                   /protein_id="ACR62445.1"
FT                   /translation="MNLQRFDDSTLIRIFALHELHRLKEHGLTRGALLDYHSRYKLVFL
FT                   AHSQPEYRKLGPFVADIHQWQNLDDYYNQYRQRVVVLLSHPANPRDHTNVLMHVQGYFR
FT                   PHIDSTERQQLAALIDSYRRGEQPLLAPLMRIKHYMALYPDAWLSGQRYFELWPRVINL
FT                   RHSGVL"
     atgaatctac aacgatttga tgacagcacc ctaatccgta tctttgccct tcatgagtta        60
     catcgactga aagaacatgg cttaacgcgc ggggcgcttc tcgattatca cagccgctat       120
     aaactcgtct ttctggcgca ttctcagccg gagtaccgca aacttggccc gttcgtggct       180
     gatattcacc agtggcaaaa tctggatgac tattacaacc agtaccgcca acgcgtagtt       240
     gttttgcttt ctcaccccgc caacccgcgc gatcacacca atgttttgat gcacgttcag       300
     ggttattttc gcccgcatat tgattccaca gaacgccagc agctggctgc gcttatcgac       360
     agttatcgcc gtggcgagca accacttctt gcgccgctga tgcgtatcaa acactatatg       420
     gcgctttatc ctgacgcctg gctttcaggg cagcgttatt tcgaactttg gccgcgtgtg       480
     attaacttgc gccattcagg agttttatga                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page